PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009775282.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HB-PHD
Protein Properties Length: 747aa    MW: 82623.3 Da    PI: 5.2264
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009775282.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox41.81.8e-13569619555
                     SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                      t+ +  +++L e F++n+yp+++++e+L k+lgLt  qV+ WF N R  +
  XP_009775282.1 569 KTYGEGAIKRLYESFKENQYPDRDAKEKLGKELGLTAHQVSKWFENARHCH 619
                     566777899**************************************9755 PP

2PHD383.8e-13224279151
                     SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
             PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                     +C+ Cg+    ++++++lCdg C++ fH+ Cl+++l +e++p +   wlC+ C++k
  XP_009775282.1 224 FCAKCGAkdLPADNDIILCDGaCERGFHQLCLEPPLLKEDIPPDdeGWLCPGCDCK 279
                     6999*9966566********66*******************99999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579032.44E-13215282IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.101.1E-12221279IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001610.95222279IPR019787Zinc finger, PHD-finger
SMARTSM002493.6E-9224277IPR001965Zinc finger, PHD-type
CDDcd155041.90E-25224276No hitNo description
PfamPF006281.2E-10224279IPR019787Zinc finger, PHD-finger
PROSITE patternPS013590225276IPR019786Zinc finger, PHD-type, conserved site
PROSITE profilePS5007113.783562622IPR001356Homeobox domain
SuperFamilySSF466898.13E-13564627IPR009057Homeodomain-like
SMARTSM003892.8E-12565626IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.6E-13566616IPR009057Homeodomain-like
CDDcd000862.87E-11567623No hitNo description
PfamPF000465.7E-11569620IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 747 aa     Download sequence    Send to blast
MRPQLEDQTE MSTLGNTAVS PGKVARTTAR GHNTALAGKM SENPGVEQLG DAFENAVQKL  60
NLSECQEKTP GQPRKRKSTS GTPISSTRLL RSKSKEKSGA SEVNNTVVTD EANEEKKRKR  120
RKKKHSKHIA VNEFTSIRGH LRYLLQRIKY EQTLIEAYSG EGWKGQSLEK IKLEKELERA  180
KAHIFRYKLK IRDLFQRVDA LLAQGRLPAS LFDNEGEIDS EDIFCAKCGA KDLPADNDII  240
LCDGACERGF HQLCLEPPLL KEDIPPDDEG WLCPGCDCKV DCIDLLNDLQ GTNLSITDSW  300
EKVYPKEAAA AASGEKLDDI SGLPSDDSED DDYNPENPDV EKNDSGDESS SDESDFFSAS  360
EDLEEVPPKD DEILALPSED SEDGDYSPDD PDKDEPAKTE SSSSDFTSDS EDLGLIVDTN  420
RLPGDELGVS SSVDNSKPSL ASQEEKPKGG RAKRNSLNNE LSDLMLSYSP LVSCKRHIER  480
LDYKKLHDET YGNESSDSSD EDFEGDPLPK VREIRSAKAA RTSPSSTPAD TKYQSGKQKV  540
SRHTDRGLCK QLKIGGMDTS EPHSSGKKKT YGEGAIKRLY ESFKENQYPD RDAKEKLGKE  600
LGLTAHQVSK WFENARHCHR HSSRWDSIMS QKVSKESPSS PNIIGEPLGT ESKSTINNVL  660
CNGVGKVEPP KQCLNGENCH AIGKSEGDLL IRETSGKKSR KPKAKNDTTD RGLDDSPANK  720
TSKKWNAQVD TPNSQNVRRS SRLQKQG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1115120KKRKRR
2115122KKRKRRKK
3115123KKRKRRKKK
4116121KRKRRK
5117123RKRRKKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754401e-180HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009775281.10.0PREDICTED: pathogenesis-related homeodomain protein
RefseqXP_009775282.10.0PREDICTED: pathogenesis-related homeodomain protein
TrEMBLA0A0V0IXY30.0A0A0V0IXY3_SOLCH; Putative pathogenesis-related homeodomain protein-like
STRINGSolyc01g107410.2.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.19e-82Homeodomain-like protein with RING/FYVE/PHD-type zinc finger domain