PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009774081.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 410aa    MW: 44862.1 Da    PI: 10.0139
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009774081.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_139.51.2e-12332382555
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                     +r rr++kNRe+A rsR+RK+a++ eLe +v++L++ N++L+k+  e+ ++
  XP_009774081.1 332 RRRRRMIKNRESAARSRARKQAYTLELEAEVAKLKEINEELRKKQAEIMEK 382
                     689***************************************987776654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.9E-11328392IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.944330382IPR004827Basic-leucine zipper domain
PfamPF001708.7E-11332388IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.3E-12332384No hitNo description
SuperFamilySSF579594.43E-9332381No hitNo description
PROSITE patternPS000360335350IPR004827Basic-leucine zipper domain
CDDcd147072.18E-22337386No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MGSYLNFKNF ADSPQPESNG GNSMCNGNFP LARQSSIYSL TFDELQTTFS GLGKDFGSMN  60
MEDLLKNIWT AEETQATAST TGGVDGSVAA ENLQRQGSLT LPRTLSQKTV DEVWRDFQKE  120
TVSAKEGSDT GNSNFGQRQS TLGEMTLEEF LVRAGVVRED MQCTNSNGIT FDNGSSQKSN  180
NNGLNIAFQQ PTQNNGLLIN QIAANNMLNV VGATPSQQQP QHQQPLFPKQ TTVAFASPMQ  240
LSNNGHLASP RTRAPVVGMS GSSVNTNMAQ GGVRGMAGFH NGVSPAKGGS PGNDFVARSN  300
TDTSSLSPSP YAFNEGVRGR RSGSSLEKVV ERRRRRMIKN RESAARSRAR KQAYTLELEA  360
EVAKLKEINE ELRKKQAEIM EKQKNQLLEK RNMPCGYKLR CLRRTLTGPW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4422680.0KF442268.1 Solanum nigrum abscisic acid-insensitive 5-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009774081.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7
SwissprotQ9M7Q41e-106AI5L5_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBLV5L0710.0V5L071_SOLNI; Abscisic acid-insensitive 5-like protein
STRINGSolyc01g108080.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7762497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34000.24e-82abscisic acid responsive elements-binding factor 3