PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009774046.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 307aa    MW: 34651.8 Da    PI: 7.1232
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009774046.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.93.5e-4371061100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv kll++l+ ++reda++sl+yeAe r+rdPvyG+vg+i+ lq++l+q++ +l 
  XP_009774046.1   7 PCAACKFLRRKCTQECVFAPYFPPDQPQKFANVHKVFGASNVAKLLNELNATQREDAVNSLAYEAEYRLRDPVYGCVGLISVLQHKLKQVQDDLL 101
                     7********************************************************************************************98 PP

          DUF260  96 llkee 100
                      +k+e
  XP_009774046.1 102 NAKKE 106
                     88876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.7576107IPR004883Lateral organ boundaries, LOB
PfamPF031956.6E-437103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MSSSNSPCAA CKFLRRKCTQ ECVFAPYFPP DQPQKFANVH KVFGASNVAK LLNELNATQR  60
EDAVNSLAYE AEYRLRDPVY GCVGLISVLQ HKLKQVQDDL LNAKKELATY IGPSAMLPIL  120
QHPGYIQQHP NNPSSSTMMP YNMQPMLGLP TGMQQQQQHG AQLMLRDPQQ QQQQNHQQVI  180
EAHQFAAAMA AREQQEMLRT YEQQPQQQQH PQFNSGFDSA GPVTATGFHQ MSSSVSPSLA  240
LGSFDNPYQI QQTQQEHCGQ VQIQPHQLLQ QQQQQQNHQQ QLPQQPQTPQ QQQRAKSEEE  300
RSIGPSC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009774046.10.0PREDICTED: LOB domain-containing protein 36-like
RefseqXP_016502483.10.0PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ36e-85LBD36_ARATH; LOB domain-containing protein 36
TrEMBLK4B6V01e-149K4B6V0_SOLLC; Uncharacterized protein
STRINGSolyc02g065150.1.11e-148(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.17e-74ASYMMETRIC LEAVES 2-like 1