PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009772108.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 583aa    MW: 66206 Da    PI: 4.9082
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009772108.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS294.62.6e-902115811374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.....sseelaalklfsevsPi 90 
                     lv+lLl++Ae v++++++la++l++r    as++g+p+qRl +yf++AL++r+ rs+ +   + + ++    +        + +a+ + +++ P+
  XP_009772108.1 211 LVHLLLAAAEEVNNQQFHLARKLISRCVWVASESGSPVQRLSFYFAKALEERIDRSTGKYTCTDEDRHL---KyiktmALGTNSAFLTCHQLLPF 302
                     68*****************************************************33332222222222...122222333344555589***** PP

            GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvak 184
                      ++ +++  q+Il+ v +++++H iDf+i  G+QW  L+qaLa+++e p   l+iT+vgs   ++ke+ e tg+ L++fA++lg++f+f+++  +
  XP_009772108.1 303 SQVMQFAGVQTILDNVRSAKKIHLIDFNIRSGIQWTVLMQALAEKSECPIeLLKITAVGS---TEKEKFEVTGNTLHSFATSLGLSFSFDIVFLS 394
                     **********************************************7665499*******...579***************************** PP

            GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                     +++d++ e+ +++ +E++aV +   l ++  ++ +le+    ++k v+s+ P+v+v+ e ea+hns+sFl+rf+e+l +y a+fd++e  + r+s
  XP_009772108.1 395 DMKDFKKESVNIEADETVAVYCNTVLRTMIPKPDCLEN----LMKGVRSIGPTVIVIGEVEANHNSPSFLNRFIETLFFYGAFFDCFEDCMDRDS 485
                     ******************************99999999....***************************************************** PP

            GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaW 373
                       r+++E  ++g+ i+n+va+eg+er+ r+ +le Wr+ + ++G+ + +lse+a  qa+l+l++++ +   +++++ + l++gWk+ p+ s+S W
  XP_009772108.1 486 PCRRTIEGLYFGEGIRNIVAAEGKERFTRNVKLEVWRAFFARFGMVEEELSESAWYQANLILKQFAqGSCCNIHKDGKGLIIGWKGTPIHSLSIW 580
                     ******************************************************************77779************************ PP

            GRAS 374 r 374
                     +
  XP_009772108.1 581 K 581
                     8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.169185560IPR005202Transcription factor GRAS
PfamPF035149.0E-88211581IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 583 aa     Download sequence    Send to blast
MANVSISNDN FSDFQGGHFH LKAYERNELV VEDPWFELED CADIDSVYSM CDLNNEENTS  60
NEQVTTNLLE DQKQSISNWM QGYFSTNTDQ IKSSIEAPKN DDFQPQVLQL IGNSSNEKSN  120
PFSLASFELL NNYGRLIKKS REENSSIYNA LSYEARACNN NKLSTEEILL VAGERYIRYS  180
TQRLDGLSMF IYPYGSALSG LSIEETRDME LVHLLLAAAE EVNNQQFHLA RKLISRCVWV  240
ASESGSPVQR LSFYFAKALE ERIDRSTGKY TCTDEDRHLK YIKTMALGTN SAFLTCHQLL  300
PFSQVMQFAG VQTILDNVRS AKKIHLIDFN IRSGIQWTVL MQALAEKSEC PIELLKITAV  360
GSTEKEKFEV TGNTLHSFAT SLGLSFSFDI VFLSDMKDFK KESVNIEADE TVAVYCNTVL  420
RTMIPKPDCL ENLMKGVRSI GPTVIVIGEV EANHNSPSFL NRFIETLFFY GAFFDCFEDC  480
MDRDSPCRRT IEGLYFGEGI RNIVAAEGKE RFTRNVKLEV WRAFFARFGM VEEELSESAW  540
YQANLILKQF AQGSCCNIHK DGKGLIIGWK GTPIHSLSIW KFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-4224058132375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2389180.0AC238918.11 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-210f9 map 1, complete sequence.
GenBankHG9755130.0HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009772108.10.0PREDICTED: scarecrow-like protein 18
RefseqXP_016496726.10.0PREDICTED: scarecrow-like protein 18
TrEMBLA0A1S4C6M50.0A0A1S4C6M5_TOBAC; scarecrow-like protein 18
TrEMBLA0A1U7W0H80.0A0A1U7W0H8_NICSY; scarecrow-like protein 18
STRINGXP_009772108.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46941842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.13e-49RGA-like 1