PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009767942.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 563aa    MW: 62467.2 Da    PI: 6.6656
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009767942.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26069.38.6e-2246654125100
          DUF260  25 eqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                     ++ +++a v k++ +++++++l++lpe++r da+ss+vyeA+ar+rdPvyG+vg i +lq+q++ l+ +la++++e
  XP_009767942.1 466 DELERLAKVSKFYDRAELQEFLQKLPEHQRGDAVSSMVYEANARVRDPVYGCVGAIASLQNQVSLLQMQLAVAQAE 541
                     5678999****************************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089111.931439542IPR004883Lateral organ boundaries, LOB
PfamPF031955.3E-21464539IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 563 aa     Download sequence    Send to blast
MSPDISRYSV ADFPQHGSAL IAGLGNYLAV PVFEPLSNER AGVLEIIGDK KGSFSQDFVQ  60
MVYEMLNKVD LRSSNIYGHP DKKQGLRGLE RALKEIEEQL SFICRTHQLP LAQTWLPILD  120
GSSIKRFMTT KEQFCICTSA GYEFRAACDM FHLGKSQGVV SKAFLTRSSC FCSDITQLSM  180
IEYPLAHVAH RVGLHSSFAM CLQSSYTGDY VYLLEFFLPQ DNKSDCRSPQ TILNMLLASM  240
ERQFRSFKLA SGQKLGEKLS VEIIPVPSDD GLNSFEICHG VKPLSDIEAV ARPGKIEWFD  300
PLNRLLKSGN TVHICPENID LTTSSRTANT TTKLTNVRVL TNRVVSNSSE EESMMKISEG  360
HHRINRVVLQ QSVGAKVNGT ETTLASQSAP NSLGTKHLEI NDMNCSSYQL QSAKVADRHC  420
EESSGGETTT SLTHAAKPAT QAVGVQNEST VPRKCPKFLL SGVRGDELER LAKVSKFYDR  480
AELQEFLQKL PEHQRGDAVS SMVYEANARV RDPVYGCVGA IASLQNQVSL LQMQLAVAQA  540
EVVCMQMTMD MEEPQKLWEP LWS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754502e-42HG975450.1 Solanum pennellii chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009767942.10.0PREDICTED: protein NLP6-like isoform X5
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.19e-47NIN like protein 7