PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009767940.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 717aa    MW: 80122.4 Da    PI: 6.6282
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009767940.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26068.81.2e-2162069525100
          DUF260  25 eqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                     ++ +++a v k++ +++++++l++lpe++r da+ss+vyeA+ar+rdPvyG+vg i +lq+q++ l+ +la++++e
  XP_009767940.1 620 DELERLAKVSKFYDRAELQEFLQKLPEHQRGDAVSSMVYEANARVRDPVYGCVGAIASLQNQVSLLQMQLAVAQAE 695
                     5678999****************************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089111.931593696IPR004883Lateral organ boundaries, LOB
PfamPF031957.5E-21618693IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 717 aa     Download sequence    Send to blast
MAGRNEAFRI CGSVSEALSY MPCPLQYTEP NTKNDLWVFW SQHNNEFPSV FPSTADTTIY  60
HDSIKEKIAS ALKNAYISDN FGCWLVQFWA PVTTKDQVFL TTCDLPFGLT KLHEGLCFYR  120
SECLKFRIPI VTDCSENEYR LGPTERVFKH GLPKMSPDIS RYSVADFPQH GSALIAGLGN  180
YLAVPVFEPL SNERAGVLEI IGDKKGSFSQ DFVQMVYEML NKVDLRSSNI YGHPDKKQGL  240
RGLERALKEI EEQLSFICRT HQLPLAQTWL PILDGSSIKR FMTTKEQFCI CTSAGYEFRA  300
ACDMFHLGKS QGVVSKAFLT RSSCFCSDIT QLSMIEYPLA HVAHRVGLHS SFAMCLQSSY  360
TGDYVYLLEF FLPQDNKSDC RSPQTILNML LASMERQFRS FKLASGQKLG EKLSVEIIPV  420
PSDDGLNSFE ICHGVKPLSD IEAVARPGKI EWFDPLNRLL KSGNTVHICP ENIDLTTSSR  480
TANTTTKLTN VRVLTNRVVS NSSEEESMMK ISEGHHRINR VVLQQSVGAK VNGTETTLAS  540
QSAPNSLGTK HLEINDMNCS SYQLQSAKVA DRHCEESSGG ETTTSLTHAA KPATQAVGVQ  600
NESTVPRKCP KFLLSGVRGD ELERLAKVSK FYDRAELQEF LQKLPEHQRG DAVSSMVYEA  660
NARVRDPVYG CVGAIASLQN QVSLLQMQLA VAQAEVVCMQ MTMDMEEPQK LWEPLWS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754503e-42HG975450.1 Solanum pennellii chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009767937.10.0PREDICTED: protein NLP7-like isoform X3
RefseqXP_009767938.10.0PREDICTED: protein NLP7-like isoform X3
RefseqXP_009767939.10.0PREDICTED: protein NLP7-like isoform X3
RefseqXP_009767940.10.0PREDICTED: protein NLP7-like isoform X3
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.12e-59NIN like protein 7