PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009767936.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 719aa    MW: 80381.7 Da    PI: 6.7135
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009767936.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26068.81.2e-2162269725100
          DUF260  25 eqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                     ++ +++a v k++ +++++++l++lpe++r da+ss+vyeA+ar+rdPvyG+vg i +lq+q++ l+ +la++++e
  XP_009767936.1 622 DELERLAKVSKFYDRAELQEFLQKLPEHQRGDAVSSMVYEANARVRDPVYGCVGAIASLQNQVSLLQMQLAVAQAE 697
                     5678999****************************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089111.931595698IPR004883Lateral organ boundaries, LOB
PfamPF031957.5E-21620695IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 719 aa     Download sequence    Send to blast
MKMAGRNEAF RICGSVSEAL SYMPCPLQYT EPNTKNDLWV FWSQHNNEFP SVFPSTADTT  60
IYHDSIKEKI ASALKNAYIS DNFGCWLVQF WAPVTTKDQV FLTTCDLPFG LTKLHEGLCF  120
YRSECLKFRI PIVTDCSENE YRLGPTERVF KHGLPKMSPD ISRYSVADFP QHGSALIAGL  180
GNYLAVPVFE PLSNERAGVL EIIGDKKGSF SQDFVQMVYE MLNKVDLRSS NIYGHPDKKQ  240
GLRGLERALK EIEEQLSFIC RTHQLPLAQT WLPILDGSSI KRFMTTKEQF CICTSAGYEF  300
RAACDMFHLG KSQGVVSKAF LTRSSCFCSD ITQLSMIEYP LAHVAHRVGL HSSFAMCLQS  360
SYTGDYVYLL EFFLPQDNKS DCRSPQTILN MLLASMERQF RSFKLASGQK LGEKLSVEII  420
PVPSDDGLNS FEICHGVKPL SDIEAVARPG KIEWFDPLNR LLKSGNTVHI CPENIDLTTS  480
SRTANTTTKL TNVRVLTNRV VSNSSEEESM MKISEGHHRI NRVVLQQSVG AKVNGTETTL  540
ASQSAPNSLG TKHLEINDMN CSSYQLQSAK VADRHCEESS GGETTTSLTH AAKPATQAVG  600
VQNESTVPRK CPKFLLSGVR GDELERLAKV SKFYDRAELQ EFLQKLPEHQ RGDAVSSMVY  660
EANARVRDPV YGCVGAIASL QNQVSLLQMQ LAVAQAEVVC MQMTMDMEEP QKLWEPLWS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754503e-42HG975450.1 Solanum pennellii chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009767935.10.0PREDICTED: protein NLP7-like isoform X1
RefseqXP_009767936.10.0PREDICTED: protein NLP7-like isoform X2
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.12e-59NIN like protein 7