PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009766098.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 304aa    MW: 33562.3 Da    PI: 6.3123
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009766098.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.52.2e-11175220550
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                     kr +r   NR +A+rsR RK+++i eLe+ v +L++e +aL  ++ 
  XP_009766098.1 175 KRIKRILANRQSAQRSRVRKLQYISELERSVTSLQTEVSALSPRVA 220
                     899**********************************999987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.3E-14171235IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.703173225IPR004827Basic-leucine zipper domain
PfamPF001705.6E-10175220IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.6E-14175226No hitNo description
SuperFamilySSF579591.55E-11175229No hitNo description
CDDcd147032.51E-23176226No hitNo description
PROSITE patternPS000360178193IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MAQLPPKVPT MAHNWPFQTM PPLHNNNINN NSWVDDFLDF SSARRNSHRR SVSDPIAFVE  60
AAPFLQQCHG GANSSIGFDK LDDEQLTTMF SDDSGGAAAF AVTTAPSSNP SSTNPSTPSD  120
QISENEDQKF VPQVDVNQVI QPKNEPGEVD SSCDTQPPPP PASDSSDNNP IVDPKRIKRI  180
LANRQSAQRS RVRKLQYISE LERSVTSLQT EVSALSPRVA FLDHQRLLLN VDNSALRQRI  240
AALAQDKIFK DAHQEALKKE IERLRQIYHE QNMKKMGNNG TAHAPPSAAA PPSTFNKMSC  300
TEEA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755194e-42HG975519.1 Solanum lycopersicum chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009766098.10.0PREDICTED: basic leucine zipper 61-like
RefseqXP_016452782.10.0PREDICTED: basic leucine zipper 61-like
SwissprotQ9M2K45e-96BZP61_ARATH; Basic leucine zipper 61
TrEMBLM1AXB91e-149M1AXB9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000323811e-148(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17752465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42380.22e-81bZIP family protein