PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009766015.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 172aa    MW: 18896.4 Da    PI: 7.4681
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009766015.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601452.1e-45131121100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca+dCv++pyfpa++p+kfa vhk+FGasnv k+l++lpe++r da+ss+vyeA+ar+rdPvyG+vg i++lqqq+++l+++la
  XP_009766015.1  13 PCAACKLLRRRCAQDCVFSPYFPADEPQKFASVHKVFGASNVNKMLQELPEHQRGDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDHLQTQLA 107
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                      +++e
  XP_009766015.1 108 IAQAE 112
                     99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.8812113IPR004883Lateral organ boundaries, LOB
PfamPF031954.4E-4513110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MKESGRKQSA ASPCAACKLL RRRCAQDCVF SPYFPADEPQ KFASVHKVFG ASNVNKMLQE  60
LPEHQRGDAV SSMVYEANAR VRDPVYGCVG AISSLQQQID HLQTQLAIAQ AEVVHMRMRQ  120
FSSMSSGGGT AENSPENVSP SSRHTQTQPI MSLFTMDMVV DHANMGESLW SC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754501e-114HG975450.1 Solanum pennellii chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009766015.11e-128PREDICTED: LOB domain-containing protein 4-like isoform X2
RefseqXP_009766014.11e-128PREDICTED: LOB domain-containing protein 4-like isoform X1
SwissprotQ9SHE97e-79LBD4_ARATH; LOB domain-containing protein 4
TrEMBLK4D8L71e-118K4D8L7_SOLLC; Uncharacterized protein
STRINGSolyc11g045530.1.11e-118(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.14e-80LOB domain-containing protein 4