PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009764881.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 175aa    MW: 19446.2 Da    PI: 7.0697
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009764881.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.11.8e-4481071100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +Ca+Ck+lrr+CakdC++apyfp+++p+kfa+vhk+FGasn++k+l++lp ++r da+ssl+yeA+ar+rdPvyG+vg i+ lq+q+++l+ +la
  XP_009764881.1   8 PCASCKLLRRRCAKDCIFAPYFPSDDPQKFAIVHKVFGASNISKMLQELPVNKRADAVSSLAYEANARMRDPVYGCVGAISYLQNQVSRLQMQLA 102
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     l+++e
  XP_009764881.1 103 LAQAE 107
                     *9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.5787108IPR004883Lateral organ boundaries, LOB
PfamPF031959.9E-448105IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MGAAGNSPCA SCKLLRRRCA KDCIFAPYFP SDDPQKFAIV HKVFGASNIS KMLQELPVNK  60
RADAVSSLAY EANARMRDPV YGCVGAISYL QNQVSRLQMQ LALAQAEILC IQMQSQDHHP  120
ANLLPMSPPI HDQLVAADDE KSFLNLSHYL NNFESHKCNS DISQEGVFLW TGQYL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009764881.11e-129PREDICTED: LOB domain-containing protein 12-like
RefseqXP_016437290.11e-129PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW36e-72LBD12_ARATH; LOB domain-containing protein 12
TrEMBLK4C5N92e-80K4C5N9_SOLLC; Uncharacterized protein
STRINGSolyc06g050950.2.15e-80(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.14e-73LBD family protein