PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009763968.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 212aa    MW: 23208.3 Da    PI: 6.4769
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009763968.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.61.9e-42451441100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca++Cvlapyfp ++p kf  +h++FGasn++k+l++lpe++r da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+a+la
  XP_009763968.1  45 PCAACKILRRRCAEKCVLAPYFPPNNPIKFTTAHRVFGASNIIKFLQELPESQRADAVSSMVYEANARLRDPVYGCAGAICQLQKQVNELQAQLA 139
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_009763968.1 140 KAQAE 144
                     99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.05844145IPR004883Lateral organ boundaries, LOB
PfamPF031959.6E-4345142IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MEYSSDTKAT VISTSPSSSR SVSPPSSSSS SPNSPPPPPM VVVSPCAACK ILRRRCAEKC  60
VLAPYFPPNN PIKFTTAHRV FGASNIIKFL QELPESQRAD AVSSMVYEAN ARLRDPVYGC  120
AGAICQLQKQ VNELQAQLAK AQAEVVNMQC QQANLMALIC MDMDQSSPQA SPQQQSNLES  180
FTNNIPHSFQ NNMSFLDDNN NFGSVWEPLM WT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755183e-54HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
GenBankHG9754453e-54HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009763968.11e-155PREDICTED: LOB domain-containing protein 1-like
RefseqXP_016480560.11e-155PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR03e-75LBD1_ARATH; LOB domain-containing protein 1
TrEMBLM1CDT54e-95M1CDT5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000653461e-94(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.16e-62LOB domain-containing protein 1