PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009762917.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family BBR-BPC
Protein Properties Length: 282aa    MW: 31290.9 Da    PI: 10.1223
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009762917.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind348.12.1e-10612821301
       GAGA_bind   1 mdddgsrernkgyyepaaslkenlglqlmssiaerdaki...rernlalsekkaavaerd..........maflqrdkalaernkalverdnkll 82 
                     mdddg + rn+gyyep+  lk +lglqlmss+ +rd+k+   r +n  + + ++ +++rd          +++  rd+++++        ++k+l
  XP_009762917.1   1 MDDDGLNMRNWGYYEPS--LKGHLGLQLMSSVVDRDTKPfltRRENPIMLGANGMYHSRDsivpeaplshIDY-VRDSWINH--------RDKFL 84 
                     9*****99*******99..**********************9777888*******************999999.99****99........78999 PP

       GAGA_bind  83 alllvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpiee.aaeeakekkkkkkrqrakkpkekkakkkkkksekskk 176
                     ++ +          ++++vl++t+  +s+q++++p+++++              ++  ++++++e+  +k++  +++pk++kakk kk s+++k+
  XP_009762917.1  85 HMFPG--------NPYTTVLPETSASHSMQMVQQPDVTEDVR------------VNAeEPSVKNESGPSKRKTGGATPKAPKAKKLKKGSSVPKE 159
                     99993........357899************66665555433............33303445556666666677899***********9999977 PP

       GAGA_bind 177 kvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLek 271
                     + ++    +r+k  kks+d+v+ng+++D+s++P+PvCsCtGa++qCY+WG+GGWqSaCCtt+iS+yPLP+stkrrgaRiagrKmSqgafkk+Lek
  XP_009762917.1 160 NGTPRV--QRAKPAKKSMDIVINGIDMDISGIPIPVCSCTGAPQQCYRWGCGGWQSACCTTSISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEK 252
                     777666..79************************************************************************************* PP

       GAGA_bind 272 LaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                     LaaeGy+++np+DL++hWAkHGtnkfvtir
  XP_009762917.1 253 LAAEGYSFANPIDLRTHWAKHGTNKFVTIR 282
                     *****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012263.6E-1751282IPR010409GAGA-binding transcriptional activator
PfamPF062172.8E-1151282IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MDDDGLNMRN WGYYEPSLKG HLGLQLMSSV VDRDTKPFLT RRENPIMLGA NGMYHSRDSI  60
VPEAPLSHID YVRDSWINHR DKFLHMFPGN PYTTVLPETS ASHSMQMVQQ PDVTEDVRVN  120
AEEPSVKNES GPSKRKTGGA TPKAPKAKKL KKGSSVPKEN GTPRVQRAKP AKKSMDIVIN  180
GIDMDISGIP IPVCSCTGAP QQCYRWGCGG WQSACCTTSI SMYPLPMSTK RRGARIAGRK  240
MSQGAFKKVL EKLAAEGYSF ANPIDLRTHW AKHGTNKFVT IR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00253DAPTransfer from AT2G01930Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ9823000.0FJ982300.1 Nicotiana tabacum GAGA-binding transcriptional activator (BBR/BPC1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009762917.10.0PREDICTED: protein BASIC PENTACYSTEINE2-like
RefseqXP_016470419.10.0PREDICTED: protein BASIC PENTACYSTEINE2-like
SwissprotQ9SKD01e-113BPC1_ARATH; Protein BASIC PENTACYSTEINE1
TrEMBLH1ZN830.0H1ZN83_TOBAC; GAGA-binding transcriptional activator
STRINGPGSC0003DMT4000757030.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA90612429
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.31e-105basic pentacysteine 2