PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009761371.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family BBR-BPC
Protein Properties Length: 309aa    MW: 34530.5 Da    PI: 9.9236
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009761371.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind318.12.8e-9713091301
       GAGA_bind   1 mdddgsrernkgyyepa.aslkenlglqlmssiaerdakirernlalsekkaavaerd..........................maflqrdkala 68 
                     md +g++ rn+g++epa + lk +lglqlmss+ e+    + r++  ++++++++++                           +++ +rd++++
  XP_009761371.1   1 MDGNGMNIRNWGFFEPAaTVLKGHLGLQLMSSMDEKPLFGNIRDHHHHHNHQTHQPHHptvmestnggafhhhrvcgisetpmpIEY-MRDSWVN 94 
                     88888877********9999*************776554433333335555555555456677888999999999*******99999.9****** PP

       GAGA_bind  69 ernkalverdnkllalllvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekk 163
                     +      + ++k+l++l  ++    +  +g++ l++t+s++s+q +++p+l +   +     +le+  +e+      +k+   k+q  k+pk+kk
  XP_009761371.1  95 H-----KDYRDKYLNVLSGNH----HYLTGYGFLPETSSAQSMQIHEQPNLVKVEPD----PQLEEVCLERDIGGLAKKRGAGKSQLLKSPKSKK 176
                     9.....566789999888555....57789***************888887766655....3344445555556666666666677888888888 PP

       GAGA_bind 164 akkkkkksekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagr 258
                     akk+++    +k +++++   +r++a++ks ++v+ng+++D+s +P+PvCsCtG+ +qCY+WG+GGWqSaCCtt++S yPLP++tkrrg+Riagr
  XP_009761371.1 177 AKKATRI---PKVESTPSV--PRARAPRKSAEVVINGITMDISVIPIPVCSCTGVAQQCYRWGCGGWQSACCTTNLSSYPLPMNTKRRGSRIAGR 266
                     8777773...333344444..79************************************************************************ PP

       GAGA_bind 259 KmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                     KmS gaf+k+LekLa+eGy++sn++DLk +WAkHGtnkfvtir
  XP_009761371.1 267 KMSLGAFTKVLEKLASEGYNFSNAIDLKPYWAKHGTNKFVTIR 309
                     ******************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012264.6E-1481309IPR010409GAGA-binding transcriptional activator
PfamPF062172.6E-1012309IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MDGNGMNIRN WGFFEPAATV LKGHLGLQLM SSMDEKPLFG NIRDHHHHHN HQTHQPHHPT  60
VMESTNGGAF HHHRVCGISE TPMPIEYMRD SWVNHKDYRD KYLNVLSGNH HYLTGYGFLP  120
ETSSAQSMQI HEQPNLVKVE PDPQLEEVCL ERDIGGLAKK RGAGKSQLLK SPKSKKAKKA  180
TRIPKVESTP SVPRARAPRK SAEVVINGIT MDISVIPIPV CSCTGVAQQC YRWGCGGWQS  240
ACCTTNLSSY PLPMNTKRRG SRIAGRKMSL GAFTKVLEKL ASEGYNFSNA IDLKPYWAKH  300
GTNKFVTIR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009761378.10.0PREDICTED: protein BASIC PENTACYSTEINE2-like
RefseqXP_009761371.10.0PREDICTED: protein BASIC PENTACYSTEINE2-like
RefseqXP_016499159.10.0PREDICTED: protein BASIC PENTACYSTEINE2-like
RefseqXP_016499158.10.0PREDICTED: protein BASIC PENTACYSTEINE2-like
TrEMBLA0A0V0IAS51e-172A0A0V0IAS5_SOLCH; Uncharacterized protein
STRINGPGSC0003DMT4000693031e-170(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA100482026
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.31e-82basic pentacysteine 2