PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009760513.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 411aa    MW: 44858.6 Da    PI: 10.0148
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009760513.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.52.9e-13333385557
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                     +r +r++kNRe+A rsR+RK+a++ eLe +v++L++ Nk+L k+  e  ++ +
  XP_009760513.1 333 RRRKRMIKNRESAARSRARKQAYTLELEAEVEKLKEINKELHKKQAEFIEMQK 385
                     689**************************************998776666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.7E-11329394IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.369331376IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.2E-9333381No hitNo description
CDDcd147074.91E-23333387No hitNo description
PfamPF001702.9E-11333389IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.1E-12333389No hitNo description
PROSITE patternPS000360336351IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MGSYMNFKNF ADTPLTESNG GMSMGSGNFP LARQSSVYSL TFDELQSTCG LGKDLGSMNL  60
EDLLKNIWTA EESNVVASAA GVGNANTTGG NLQRQGSLTL PRTLSQKTVD EVWRDFQKET  120
TISSKDGSGT EWPNLGQRQS TLGEMTLEEF LVRAGVVRED MQPTGSSTDV RFTGGLSQPS  180
TNNNGLNIAF QQPTQTPGLL SNQFEDNNML NVVSATSSQQ ILNVAFTSPM QLGTNVQLAN  240
AGAREPAVSM SSPSVNTSTI VQGSVMQGGT KGLAGLRNGV TPAKRGSPGN QLSPDMMSKK  300
VLDRSSLSPS PYAFIEGGKG RRPCNSLEKV VERRRKRMIK NRESAARSRA RKQAYTLELE  360
AEVEKLKEIN KELHKKQAEF IEMQKNQLME KMNMPWGNKL RCLRRTLTGP W
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0736390.0DQ073639.1 Nicotiana tabacum bZIP mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009760513.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 6
RefseqXP_016441338.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 6 isoform X2
SwissprotQ9M7Q31e-97AI5L6_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 6
TrEMBLQ4PKH10.0Q4PKH1_TOBAC; BZIP
STRINGPGSC0003DMT4000158920.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7762497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34000.27e-81abscisic acid responsive elements-binding factor 3