PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009760139.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 280aa    MW: 31315.9 Da    PI: 4.7629
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009760139.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_124.36.6e-08100162163
                     XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                     eke +r rr   NRe+Ar   +R++a +eeL++k++ L  eN+ Lkk+ e    e+++l++++
  XP_009760139.1 100 EKEGRRLRRVFANRESARQTIRRRQAMQEELTRKAADLALENENLKKNKELAAAEYSSLRNKN 162
                     78889*********************************************99*******9998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-5100164IPR004827Basic-leucine zipper domain
PfamPF001702.0E-7100162IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.427102165IPR004827Basic-leucine zipper domain
CDDcd147022.11E-10105156No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MNYEEIHKSA PCTADGRFSD DKLVEFEWEA AEALARLSHP VTGDVQLCMD ARDAAGLYST  60
EQEIAIQSED ESELDTSLLC ASNNPPVTSG KLRQDLTEAE KEGRRLRRVF ANRESARQTI  120
RRRQAMQEEL TRKAADLALE NENLKKNKEL AAAEYSSLRN KNNSLKTQMA KIVKAEVQET  180
DDESKLITSV ETPSTSTTFP TFLHNQTQAT PFFWSFQPLD GLPLQSGSQS ISGITRQLPI  240
PLGEFKPSDQ LTRKSRDDEQ ARDSFIYTSV PLADAIPCAK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009760139.10.0PREDICTED: uncharacterized protein LOC104212541
RefseqXP_016489881.10.0PREDICTED: uncharacterized protein LOC107809726
TrEMBLK4CR053e-43K4CR05_SOLLC; Uncharacterized protein
STRINGSolyc09g009760.1.18e-43(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA54171724
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.15e-14bZIP family protein