PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009759227.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family G2-like
Protein Properties Length: 350aa    MW: 40973 Da    PI: 9.8573
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009759227.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like971.4e-3062115255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     prlrWtp+LH +Fv+a+e+LGG+e+AtPk +l++m+v gL+++hvkSHLQ+YR+
  XP_009759227.1  62 PRLRWTPDLHLSFVRAIERLGGQERATPKLVLQTMNVRGLSIAHVKSHLQMYRS 115
                     8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-2858116IPR009057Homeodomain-like
PROSITE profilePS5129411.61758118IPR017930Myb domain
SuperFamilySSF466898.24E-1461116IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-2262117IPR006447Myb domain, plants
PfamPF002491.1E-763114IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MEKVSYSIDL NEEANNKRET DEAIELSDDM IEKTAEGNGS SEDIGNEDKC SRVRQYVRSK  60
LPRLRWTPDL HLSFVRAIER LGGQERATPK LVLQTMNVRG LSIAHVKSHL QMYRSKKLGE  120
FGQVLGHAHR AMQGKSYFYG NPRQIFNPLQ DFKMKNGAIV LARNFNDDDD NVNHHFQNSL  180
SRPRHETKEI FSRYLEWSSN QGTNNLFRMK ILQAGNHEIG PVRQSHFLEE KRWPPNEFKE  240
NQYWKEKRVS LSNISSNKNS QSLFQQNNFV QQPKWRWRYN SLEPKFETPF RLEMKRDKRL  300
SEKDWMPDLQ LGLSTIDNNK EQIQQSKKES DSTLNTMLSL SLPSYSSSAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-1763117458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-1763117458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A4e-1763117357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-1763117357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-1763117357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-1763117357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-1763117458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-1763117458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-1763117458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-1763117458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-1763117458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-1763117458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755157e-32HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009759227.10.0PREDICTED: putative Myb family transcription factor At1g14600
RefseqXP_009759228.10.0PREDICTED: putative Myb family transcription factor At1g14600
TrEMBLA0A1U7UT320.0A0A1U7UT32_NICSY; putative Myb family transcription factor At1g14600
STRINGXP_009759227.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA55162334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.13e-39G2-like family protein