PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009758697.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family CO-like
Protein Properties Length: 341aa    MW: 37860.3 Da    PI: 6.0019
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009758697.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box16.22.2e-051143436
        zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg 36
                    + C+ ++   ++ fC+ ++ +lC  C  ++H  
  XP_009758697.1 11 KLCDSCKTTSATVFCRADSAFLCLGCDCKIHAA 43
                    68******99*****************999954 PP

2zf-B_box25.43e-085395339
        zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                     ++C+ +e+ +++  C+ +   lC +C   +H+       H++
  XP_009758697.1 53 VWVCEVCEQAPASVTCKADAAALCVTCDRDIHSAnplarrHER 95
                    689*****************************65777777776 PP

3CCT69.96.6e-24278321144
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                     Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  XP_009758697.1 278 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 321
                     9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.911855IPR000315B-box-type zinc finger
SMARTSM003369.6E-9855IPR000315B-box-type zinc finger
CDDcd000211.05E-51255No hitNo description
PROSITE profilePS5011910.5945198IPR000315B-box-type zinc finger
PfamPF006432.0E-65397IPR000315B-box-type zinc finger
CDDcd000211.33E-85498No hitNo description
SMARTSM003361.6E-105698IPR000315B-box-type zinc finger
PfamPF062035.0E-18278320IPR010402CCT domain
PROSITE profilePS5101716.787278320IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MSSENWSLTA KLCDSCKTTS ATVFCRADSA FLCLGCDCKI HAANKLASRH ARVWVCEVCE  60
QAPASVTCKA DAAALCVTCD RDIHSANPLA RRHERFPVVP FYDSAVAKSH GGVNDDEKYF  120
DSHENNPQPE EEAEAASWIL PTPKEGTDNQ YKSADYLFND MDSYLDMDIM SCDQKPHNIL  180
QLHQQYCSDG VVPVQNKNES SHLQGPVVDG FPTYEMDFIG SKPYLYNFNS QSISQSVSSS  240
SMDVGVVPEH SAMADVSNSL VMNSSADTVA NAVSGLDREA RVLRYREKRK NRKFEKTIRY  300
ASRKAYAETR PRIKGRFAKR TEIEVDSLLA ADASYGVVPS F
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009758697.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 4-like
RefseqXP_016478497.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 4-like
SwissprotQ940T91e-101COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLA0A1S4AP330.0A0A1S4AP33_TOBAC; zinc finger protein CONSTANS-LIKE 4-like
TrEMBLA0A1U7URH80.0A0A1U7URH8_NICSY; zinc finger protein CONSTANS-LIKE 4-like
STRINGXP_009758697.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.13e-99CONSTANS-like 4