PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009758504.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WOX
Protein Properties Length: 246aa    MW: 27965.2 Da    PI: 8.2143
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009758504.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.56.2e-201978357
                    --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
        Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                    +R+++tkeq++ Le+ +++  r+psae++++++ +l    +++ ++V++WFqN++a++++
  XP_009758504.1 19 SRWNPTKEQIDLLESIYRQgIRTPSAEQIQQITLRLrafgHIEGKNVFYWFQNHKARQRQ 78
                    6*****************99**************************************97 PP

2Wus_type_Homeobox114.36e-371880365
  Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                        +RW+Pt+eQi +Le++y++G+rtP++e+iq+it +L+++G+ie+kNVfyWFQN+kaR+rqkq
     XP_009758504.1 18 GSRWNPTKEQIDLLESIYRQGIRTPSAEQIQQITLRLRAFGHIEGKNVFYWFQNHKARQRQKQ 80
                       58***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.6571479IPR001356Homeobox domain
SuperFamilySSF466892.82E-121683IPR009057Homeodomain-like
SMARTSM003891.9E-41683IPR001356Homeobox domain
PfamPF000461.2E-171978IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.8E-81978IPR009057Homeodomain-like
CDDcd000861.27E-62080No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MNDDNNSVEM LVSETPVGSR WNPTKEQIDL LESIYRQGIR TPSAEQIQQI TLRLRAFGHI  60
EGKNVFYWFQ NHKARQRQKQ KQDKFAYFNR FLHRTNVFPP PRPNVVCSPY YTPQNNLGFY  120
QQYPVPSLIL PGPGGFKRRA TCDAAVFINA TYSQENSNNM AHLSPNEKQF NHQETLNLFP  180
LHPTGILQEK TTSSSSPSAH DQSTIPSNYT PSNLAEANCF TDLGIGAGDH QVFNFFCGKG  240
PCESQY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754453e-70HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009758504.10.0PREDICTED: WUSCHEL-related homeobox 2
RefseqXP_016513970.10.0PREDICTED: WUSCHEL-related homeobox 2-like
TrEMBLA0A1S4DKP70.0A0A1S4DKP7_TOBAC; WUSCHEL-related homeobox 2-like
TrEMBLA0A1U7V8C90.0A0A1U7V8C9_NICSY; WUSCHEL-related homeobox 2
STRINGXP_009758504.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA114141925
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.13e-40WUSCHEL related homeobox 2