PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009758031.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 226aa    MW: 24933.8 Da    PI: 8.4089
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009758031.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260146.66.9e-46131121100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv+kll++l++++reda++sl+yeA++r+rdPvyG+vgvi+ lq+ql+ql+ +l+
  XP_009758031.1  13 PCAACKFLRRKCQPECVFAPYFPPDQPQKFANVHKVFGASNVTKLLNELQPHQREDAVNSLAYEADMRLRDPVYGCVGVISLLQHQLRQLQMDLS 107
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                      +k+e
  XP_009758031.1 108 CAKSE 112
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.2212113IPR004883Lateral organ boundaries, LOB
PfamPF031954.5E-4513110IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009799Biological Processspecification of symmetry
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009954Biological Processproximal/distal pattern formation
GO:0048441Biological Processpetal development
GO:0005654Cellular Componentnucleoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MSSSSSSLSS NSPCAACKFL RRKCQPECVF APYFPPDQPQ KFANVHKVFG ASNVTKLLNE  60
LQPHQREDAV NSLAYEADMR LRDPVYGCVG VISLLQHQLR QLQMDLSCAK SELSKYQNLG  120
GIAGTTTHGL LAAAAAAAAT TAHHHQQFNF MAGGGRDHHH HLYHHHQFFP RDQSQQQQQH  180
QHMIRAFEGH GSNNFDASSL LIGQLSQFQQ PRAAGGDGRR TPVDPS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00211DAPTransfer from AT1G65620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009758031.11e-168PREDICTED: LOB domain-containing protein 6-like
SwissprotO044797e-88LBD6_ARATH; LOB domain-containing protein 6
TrEMBLK4D5E31e-114K4D5E3_SOLLC; Uncharacterized protein
STRINGSolyc11g008830.1.11e-114(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.41e-75LBD family protein