PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009757881.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 161aa    MW: 17667.9 Da    PI: 8.1922
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009757881.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.71.8e-4211109199
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC ++C++apyfp e+p kf  vhk+FGasnv+kll+++++++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l++el+
  XP_009757881.1  11 PCAACKFLRRKCLPSCIFAPYFPPEEPIKFTTVHKVFGASNVSKLLNEIQPHQREDAVNSLAYEAEARLKDPVYGCVGAISVLQKQVIRLQKELD 105
                     7*********************************************************************************************9 PP

          DUF260  96 llke 99 
                     ++++
  XP_009757881.1 106 ATNA 109
                     9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.01210111IPR004883Lateral organ boundaries, LOB
PfamPF031953.3E-4211108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MSSSSSYSNP PCAACKFLRR KCLPSCIFAP YFPPEEPIKF TTVHKVFGAS NVSKLLNEIQ  60
PHQREDAVNS LAYEAEARLK DPVYGCVGAI SVLQKQVIRL QKELDATNAD LMRYANYESG  120
GGTGTLIGLT YGMFGHRYSS AWNSRINSGD YNNGIDGDSG R
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754411e-110HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009757880.11e-119PREDICTED: LOB domain-containing protein 25-like isoform X1
RefseqXP_009757881.11e-119PREDICTED: LOB domain-containing protein 25-like isoform X1
RefseqXP_016497959.11e-119PREDICTED: LOB domain-containing protein 25-like isoform X1
SwissprotQ8L8Q31e-67LBD25_ARATH; LOB domain-containing protein 25
TrEMBLM1A9H46e-85M1A9H4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000178052e-84(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.17e-66LOB domain-containing protein 25