PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_025377-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family G2-like
Protein Properties Length: 297aa    MW: 31980.9 Da    PI: 6.948
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_025377-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.71.6e-3086139155
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  NNU_025377-RA  86 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 139
                    59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.05983142IPR017930Myb domain
SuperFamilySSF466892.78E-2083143IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-3085144IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-2487139IPR006447Myb domain, plants
PfamPF002491.1E-789138IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MREEESNWFS RWEEELPSPD ELISLSQTLI TPDLAIAFDI RNPNPSSQPP PTPPPPPSSQ  60
PHSVEFDSGE LGSGAAGDEP ARTLKRPRLV WTPQLHKRFV DAVAHLGIKN AVPKTIMQLM  120
SVDGLTRENV ASHLQKYRLY LKRMQGLSGS GGGGVGAAGL PPADPATDHL FASAPVPPHF  180
LHPARPASDH FLPFVPVTLQ HHHQQQMAAA AVAAAHQHHQ QQQQFHHRQV GHFGSPPGGQ  240
FEHGFLTRQP QPVHRMMAPI PGQPPAYVED LESATGGGGG GGGGGRKVLT LFPTGDD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A4e-3286142157Transcription factor LUX
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as a negative regulator of freezing tolerance via a CBF-independent pathway. {ECO:0000269|PubMed:20331973}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought, salt and abscisic acid (ABA). Down-regulated by cold. {ECO:0000269|PubMed:20331973}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010246366.10.0PREDICTED: transcription factor PCL1
RefseqXP_010246367.10.0PREDICTED: transcription factor PCL1
RefseqXP_010246368.10.0PREDICTED: transcription factor PCL1
SwissprotO222106e-62MYBC1_ARATH; Transcription factor MYBC1
TrEMBLA0A1U7Z6810.0A0A1U7Z681_NELNU; transcription factor PCL1
STRINGXP_010246366.10.0(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10760.11e-80G2-like family protein
Publications ? help Back to Top
  1. Sardesai N,Laluk K,Mengiste T,Gelvin S
    The Arabidopsis Myb transcription factor MTF1 is a unidirectional regulator of susceptibility to Agrobacterium.
    Plant Signal Behav, 2018.
    [PMID:24785741]