PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_024688-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family G2-like
Protein Properties Length: 356aa    MW: 40085.5 Da    PI: 8.5559
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_024688-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.13.5e-32179232255
        G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  NNU_024688-RA 179 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 232
                    9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.74E-15176232IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-28177232IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-23179232IPR006447Myb domain, plants
PfamPF002492.3E-7180231IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPNSK PTSGWKRTDE ELDLGFWRRA LDSNNTITSM AKSDTGFELS  60
LSNPRTSETN SNHLHHLLHH GHSNLIHANQ HHHHHHQNQQ NQYLHQQQAL QQELGFLKPI  120
RGIPVYHNLP SFPFVPQHTL DSSASTTTTT TSTSFPSHQS LMRSRFLSRF PAKRSMRAPR  180
MRWTTTLHAR FVHAVELLGG HERATPKSVL ELMDVKDLTL AHVKSHLQMY RTVKTTDRPA  240
ASGQPDGFDN GSAGEVSDDI MHESRGSELT VQQGRQSMHQ DQDYCGLWSN NSSSREAWLH  300
GKPRDSVGHT PPFEKEMDPK SLNYERISDL NSSSLTAGTG TSPKKPNLEF TLGRAV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A6e-16180234458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B6e-16180234458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A6e-16180234357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-16180234357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-16180234357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-16180234357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A6e-16180234458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C6e-16180234458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D6e-16180234458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F6e-16180234458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H6e-16180234458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J6e-16180234458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates lateral organ polarity. Promotes abaxial cell fate during lateral organd formation. Functions with KAN1 in the specification of polarity of the ovule outer integument. {ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:17307928}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010245225.10.0PREDICTED: probable transcription factor KAN2 isoform X1
SwissprotQ9C6164e-85KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A1U7ZBK80.0A0A1U7ZBK8_NELNU; probable transcription factor KAN2 isoform X1
STRINGXP_010245225.10.0(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.11e-50G2-like family protein
Publications ? help Back to Top
  1. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]