PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_022387-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB_related
Protein Properties Length: 454aa    MW: 51182.1 Da    PI: 10.0885
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_022387-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.71.1e-07131172446
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      WT+eE ++l d+++++  + +  Ia +++  Rt +++k+r+++
    NNU_022387-RA 131 WTKEETDQLFDLCERFDLR-FIVIADRFPSSRTVEELKNRYYS 172
                      *******************.*********************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF162827.2E-31103177IPR032563DAMP1, SANT/Myb-like domain
SMARTSM007171.3E-6127176IPR001005SANT/Myb domain
SuperFamilySSF466895.06E-7127179IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-6130174IPR009057Homeodomain-like
CDDcd116583.82E-19131173No hitNo description
PfamPF054993.8E-6317384IPR008468DNA methyltransferase 1-associated 1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0000812Cellular ComponentSwr1 complex
GO:0035267Cellular ComponentNuA4 histone acetyltransferase complex
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 454 aa     Download sequence    Send to blast
MDAKDILGLP KTSFPAPQEK KSRPQKDSQR KPDGISREVY ALTGGLAPIM PAIDVSHLKK  60
RTQSEKGKVT WQWLPFTSSA RKDNLQLYHW VRVVNGVPPT GDYSFAKYNK SVDIIKYTDE  120
EYEKYLTDPM WTKEETDQLF DLCERFDLRF IVIADRFPSS RTVEELKNRY YSVSRAIIVA  180
RAPSPADVAG HPLVKEPYNV SQEVERKRAL SMVLSQTKQQ ERKDAEVLAE AKRITESRML  240
AKGAEEAELR AASGVAPEST ERVTTAAESV SPSSNNQQQS GVVATTATAD ASSTPASLRM  300
LRVYLRTTVL EQMVQAASSS AGLRTIKRVD QFLQDLGVNI KPKVPTKAVC AEHLELRKEI  360
LTLLNLQKQL QYKEAESSSH RDSSYAEAAS TPKRLHRGGD QDRSFIPSSI NFGGERVGKR  420
EHKRKAEIRY LYLHLTGRSQ LVGERFQRQR TARL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3hm5_A3e-21102187493DNA methyltransferase 1-associated protein 1
4iej_A3e-21102187493DNA methyltransferase 1-associated protein 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling. Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. {ECO:0000305|Ref.5}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010241543.10.0PREDICTED: SWR1-complex protein 4
SwissprotQ8VZL60.0SWC4_ARATH; SWR1-complex protein 4
TrEMBLA0A1U7Z4440.0A0A1U7Z444_NELNU; SWR1-complex protein 4
STRINGXP_010241543.10.0(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47210.10.0MYB_related family protein
Publications ? help Back to Top
  1. Gómez-Zambrano Á, et al.
    Arabidopsis SWC4 Binds DNA and Recruits the SWR1 Complex to Modulate Histone H2A.Z Deposition at Key Regulatory Genes.
    Mol Plant, 2018. 11(6): p. 815-832
    [PMID:29604400]