PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_022348-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family G2-like
Protein Properties Length: 320aa    MW: 34981.9 Da    PI: 6.4211
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_022348-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like40.17.8e-133965127
        G2-like  1 kprlrWtpeLHerFveaveqLGGsekA 27
                   kprlrWt eLHerFv+av+qLGG++  
  NNU_022348-RA 39 KPRLRWTAELHERFVDAVTQLGGPDIS 65
                   79*********************9865 PP

2G2-like51.42.3e-16791082655
        G2-like  26 kAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    +AtPkti+++m+vkgLtl+h+kSHLQkYRl
  NNU_022348-RA  79 EATPKTIMRTMGVKGLTLYHLKSHLQKYRL 108
                    7****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.3E-3036109IPR009057Homeodomain-like
SuperFamilySSF466897.17E-1438111IPR009057Homeodomain-like
PfamPF002492.6E-741107IPR001005SANT/Myb domain
TIGRFAMsTIGR015575.9E-1079109IPR006447Myb domain, plants
PfamPF143795.1E-27153199IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009567Biological Processdouble fertilization forming a zygote and endosperm
GO:0010628Biological Processpositive regulation of gene expression
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MYSGIHSLDG SVGHEDLQGS LEGTNLPGDA CLVLTTDPKP RLRWTAELHE RFVDAVTQLG  60
GPDISHLKLI IIFPNSFAEA TPKTIMRTMG VKGLTLYHLK SHLQKYRLGK QSCKEFTESS  120
KDASSVAESQ GAVSSSSSAS SRMMAQDLND GYQVTEALRV QMEVQRRLHE QLEVQRHLHL  180
RIEAQGKYLQ SILEKACKAL NEQTIASVGL EAARQELSEL AIKVSNDCLG MVPLDTIKMP  240
SLSEIAAALE EKSASNGPTR IGDCSVDSCL TSTGSPVSPM CMGSQAAMMK KRSRPMFGGD  300
SLAWESDMRQ DVEWMLPGIR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-1539110258Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-1539110258Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A3e-1539110157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-1539110157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-1539110157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-1539110157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-1539110258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-1539110258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-1539110258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-1539110258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-1539110258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-1539110258Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Probable component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). Required for female gametophyte development and function (PubMed:15634699). {ECO:0000269|PubMed:15634699, ECO:0000269|PubMed:26586833}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010241363.10.0PREDICTED: protein PHR1-LIKE 3-like isoform X1
SwissprotQ8LAJ71e-122PHL3_ARATH; Protein PHR1-LIKE 3
TrEMBLA0A1U7YU950.0A0A1U7YU95_NELNU; protein PHR1-LIKE 3-like isoform X1
STRINGXP_010241363.10.0(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.11e-117G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Sanz-Fernández M, et al.
    Screening Arabidopsis mutants in genes useful for phytoremediation.
    J. Hazard. Mater., 2017. 335: p. 143-151
    [PMID:28441590]