PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_021949-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB_related
Protein Properties Length: 178aa    MW: 20485.9 Da    PI: 5.5525
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_021949-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.51.9e-10128170145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ ++++E+ l+v+  ++ G + W++Ia +++ gRt++++  +w 
    NNU_021949-RA 128 KLEFSEDEETLIVRMYNLIGDR-WALIAGRIP-GRTAEEIEKYWT 170
                      678*****************99.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.41123173IPR017877Myb-like domain
SMARTSM007179.3E-8127175IPR001005SANT/Myb domain
PfamPF002493.7E-9129170IPR001005SANT/Myb domain
SuperFamilySSF466893.02E-8130173IPR009057Homeodomain-like
CDDcd001671.58E-8130169No hitNo description
Gene3DG3DSA:1.10.10.603.3E-12130171IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
ASFIIYCFQG DAQRDKLINL LLLFDPYNYP SNQAFQLPLH TYRSSFFSQH PFFFPHSSRD  60
SPPLLLLLIL LKCIHSTTSS SHSFSFASNK LNPRSCLSFS SLEKMADLDH SSDDTSVDSR  120
ENSSQDSKLE FSEDEETLIV RMYNLIGDRW ALIAGRIPGR TAEEIEKYWT SRYYSTSE
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46410.19e-18MYB_related family protein