PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_021405-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family G2-like
Protein Properties Length: 274aa    MW: 30935.9 Da    PI: 10.0631
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_021405-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.37.3e-332579155
        G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                   k rlrWtp+LH+rFv+av++LGG++kAtPk++l++m++kgLtl+h+kSHLQkYRl
  NNU_021405-RA 25 KSRLRWTPDLHDRFVDAVTKLGGPDKATPKSVLRVMGLKGLTLYHLKSHLQKYRL 79
                   68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-312280IPR009057Homeodomain-like
PROSITE profilePS5129412.9332282IPR017930Myb domain
TIGRFAMsTIGR015571.5E-242580IPR006447Myb domain, plants
SuperFamilySSF466898.42E-162580IPR009057Homeodomain-like
PfamPF002495.8E-92778IPR001005SANT/Myb domain
PfamPF143796.5E-22127173IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MERRCGSYSY ETGVAVGVVL SRDPKSRLRW TPDLHDRFVD AVTKLGGPDK ATPKSVLRVM  60
GLKGLTLYHL KSHLQKYRLG KQAKKEANLE SRSKSSVSDG KADGHNHMDS SVISSSAPTQ  120
NNQEERKIAE TLRYQIEVQR RLQEQIEVQK KLQKRIEAQG KYLQAILEKA QKSLSTDRKC  180
PRRLEATGSQ LTDLSPSGFM TKLREDERKG EMMRKNLLND NHDSNIQRSS FQLYQEVGEA  240
KNKENMIEGD EGSSLFDLNV KGGYEFFGPK GSGS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-212581157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-212581157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-212581157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-212581157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010278794.10.0PREDICTED: myb family transcription factor PHL11-like
RefseqXP_010278795.10.0PREDICTED: myb family transcription factor PHL11-like
TrEMBLA0A1U8BBU70.0A0A1U8BBU7_NELNU; myb family transcription factor PHL11-like
STRINGXP_010278794.10.0(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.17e-65G2-like family protein