PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_021120-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family G2-like
Protein Properties Length: 457aa    MW: 50684.9 Da    PI: 5.7222
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_021120-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.18.5e-33230284155
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    kpr+rWtpeLHerFveav++L G+ekAtPk +l+lm+v++Lt++hvkSHLQkYRl
  NNU_021120-RA 230 KPRMRWTPELHERFVEAVNKLDGAEKATPKGVLKLMNVESLTIYHVKSHLQKYRL 284
                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.833227287IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-31228285IPR009057Homeodomain-like
SuperFamilySSF466892.87E-18229284IPR009057Homeodomain-like
TIGRFAMsTIGR015574.4E-25230285IPR006447Myb domain, plants
PfamPF002495.5E-9232283IPR001005SANT/Myb domain
PfamPF143797.1E-23320367IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 457 aa     Download sequence    Send to blast
MDANCASACP PLFIRSESLN SPSRPPAPMF QLQKISPDPE PSSPVSYESY PQYPTSVFSR  60
SSTFCTDLYI SSSTSSETHR HLGNLPFLPQ PQTFDQPIAT VQSSKSPLLL SGDSSNQTEE  120
KRSEDLMKDF LNFPGDASDG SFHGANFASD SLTFTEQLDL QILSAELDIA MTDNSENPRL  180
DEIYEAPTPD SRLKCKPFHQ PIHPIQPVVP PVAGQIHSSP STPGAAAAHK PRMRWTPELH  240
ERFVEAVNKL DGAEKATPKG VLKLMNVESL TIYHVKSHLQ KYRLAKYMPE TKEDKKASSS  300
EDKKVASTSK ESDARLRRGI HITEALRLQM EVQKQLHEQL EVQRDLQLRI EEHARYLQKI  360
LEEQQKAGST LIPACELPSL SKDPEGQPVP PSACALSQQA ESKTESPSLP AKHKATDCAE  420
HEQLACQKRL CRETSPEIAE AKPEVTSDEH VVENPVP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-26230287259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-26230287259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-26230287259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-26230287259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-26230287259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-26230287259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-26230287259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-26230287259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00354DAPTransfer from AT3G13040Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010278435.10.0PREDICTED: myb family transcription factor PHL6 isoform X1
RefseqXP_010278436.10.0PREDICTED: myb family transcription factor PHL6 isoform X1
RefseqXP_010278437.10.0PREDICTED: myb family transcription factor PHL6 isoform X1
RefseqXP_019055862.10.0PREDICTED: myb family transcription factor PHL6 isoform X1
SwissprotQ949U21e-117PHL6_ARATH; Myb family transcription factor PHL6
TrEMBLA0A1U8BM730.0A0A1U8BM73_NELNU; myb family transcription factor PHL6 isoform X1
STRINGXP_010278435.10.0(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.21e-110G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Nguyen HT, et al.
    A Transcription Factor γMYB1 Binds to the P1BS cis-Element and Activates PLA2-γ Expression with its Co-Activator γMYB2.
    Plant Cell Physiol., 2016. 57(4): p. 784-97
    [PMID:26872838]