PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_020131-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB_related
Protein Properties Length: 239aa    MW: 26366 Da    PI: 10.0133
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_020131-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.19.6e-145397147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
    NNU_020131-RA 53 RESWTEQEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 97
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.91E-1747103IPR009057Homeodomain-like
PROSITE profilePS5129415.40848102IPR017930Myb domain
TIGRFAMsTIGR015578.8E-1951100IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.606.7E-751103IPR009057Homeodomain-like
SMARTSM007175.3E-1152100IPR001005SANT/Myb domain
PfamPF002491.7E-115397IPR001005SANT/Myb domain
CDDcd001678.43E-95598No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MVSVNPNPNP SDGLFLDPME MALPGLGSLA PTTTPSDDPA KKIRKPYTIT KSRESWTEQE  60
HDKFLEALQL FDRDWKKIEA FVGSKTVIQI RSHAQKYFLK VQKNGTSEHV PPPRPKRKAA  120
HPYPQKASKN APVLSQVTGA FQSSSALLEP GYILRPDSSS MLGYPIRGAT SWVHNSSPPV  180
NVSHMAKDNM GSAMPTALNN CCSSTESTPR RWPTCERTDQ GNQGPPLRGK LFPYANIIV
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010276889.11e-169PREDICTED: protein REVEILLE 6-like
SwissprotQ8H0W31e-70RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A1U8BIP11e-168A0A1U8BIP1_NELNU; protein REVEILLE 6-like
STRINGXP_010276889.11e-169(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.22e-58MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]