PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_020096-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family G2-like
Protein Properties Length: 349aa    MW: 39222.7 Da    PI: 9.8797
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_020096-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.23.4e-32177230255
        G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  NNU_020096-RA 177 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 230
                    9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.79E-15174230IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-28175230IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-23177230IPR006447Myb domain, plants
PfamPF002492.2E-7178229IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPNSK PTSGWRRTDE ELHLGFWKRA LDSNNTITSA AKPNTSFELS  60
LSNPSRASEP NSNHLHHLLH HGHSNLIHVN HQQHHQNQQH QHLHQQGLHQ ELGFLKPIRG  120
IPVYHNLPSS FPFVPQQTLD SSATTTAPTT STSFPSQSLM RSRFLSRFPA KRNMRAPRMR  180
WTTTLHARFV HAVELLGGHE RATPKSVLEL MDVKDLTLAH VKSHLQMYRT VKTTDRPAAS  240
GQPDGFENGS AGEVSDDIML DSRGSELTVQ QGRPSMHQDQ DYRGLWSNSS REAWLHGKLR  300
DSGGSTPPFE KDMDPKNLNY ERISDLNASS HTGTSPKKPN LEFTLGRAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-16178232458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-16178232458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A5e-16178232357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-16178232357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-16178232357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-16178232357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-16178232458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-16178232458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-16178232458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-16178232458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-16178232458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-16178232458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates lateral organ polarity. Promotes abaxial cell fate during lateral organd formation. Functions with KAN1 in the specification of polarity of the ovule outer integument. {ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:17307928}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010276829.10.0PREDICTED: probable transcription factor KAN2
SwissprotQ9C6162e-86KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A1U8B7310.0A0A1U8B731_NELNU; probable transcription factor KAN2
STRINGXP_010276829.10.0(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.11e-67G2-like family protein
Publications ? help Back to Top
  1. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]