PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_018792-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB_related
Protein Properties Length: 164aa    MW: 19208.4 Da    PI: 11.0318
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_018792-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.61.9e-15956148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd ll +++k++G g W +++ + g++R++k c++rw++yl
    NNU_018792-RA  9 KGAWTEEEDILLRKCIKRYGEGEWCKVPLRAGLNRCRKRCRLRWLNYL 56
                     79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.272160IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-20759IPR009057Homeodomain-like
SMARTSM007172.2E-13858IPR001005SANT/Myb domain
PfamPF002491.5E-14956IPR001005SANT/Myb domain
SuperFamilySSF466898.59E-211083IPR009057Homeodomain-like
CDDcd001673.81E-101156No hitNo description
Gene3DG3DSA:1.10.10.601.5E-66083IPR009057Homeodomain-like
SMARTSM007172261114IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MNGGLGFRKG AWTEEEDILL RKCIKRYGEG EWCKVPLRAG LNRCRKRCRL RWLNYLRPGI  60
NRGEFTLDEV DLIIRLHKLL GNRKTSRKNS KRCKELLQYT VDQQKARLQK KKRKRTPQLR  120
RSKLSGLSLV TSQKVFDGSD HWLILPVADP TSEGGCYEPI RRNT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1110115KKRKRT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010274761.16e-47PREDICTED: myb-related protein 330-like
TrEMBLA0A1L2BPG41e-45A0A1L2BPG4_NELNU; MYB transcription factor 5
TrEMBLA0A1L2BPH77e-46A0A1L2BPH7_NELNU; MYB transcription factor 5 (Fragment)
TrEMBLA0A1U8B2391e-45A0A1U8B239_NELNU; myb-related protein 330-like
STRINGXP_010274761.12e-46(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.12e-38myb domain protein 113