PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_018785-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB_related
Protein Properties Length: 92aa    MW: 10839.7 Da    PI: 10.817
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_018785-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.51.7e-141966148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+e d ll + ++++G g W +++ + g++R++k+c++rw++yl
    NNU_018785-RA 19 KGKWTEEKDILLRKFIERYGEGKWCKVPLRAGLNRCRKSCRLRWLNYL 66
                     79*********************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.5131470IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-201669IPR009057Homeodomain-like
SMARTSM007171.8E-111868IPR001005SANT/Myb domain
PfamPF002498.1E-141966IPR001005SANT/Myb domain
SuperFamilySSF466898.97E-202092IPR009057Homeodomain-like
CDDcd001671.78E-92166No hitNo description
Gene3DG3DSA:1.10.10.603.3E-67092IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 92 aa     Download sequence    Send to blast
MQSKTRSSEV MDGGLGLRKG KWTEEKDILL RKFIERYGEG KWCKVPLRAG LNRCRKSCRL  60
RWLNYLRPGI KRGEFTSDEV DLIIRFHKLL GN
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1, or BHLH042/TT8. {ECO:0000269|PubMed:15361138}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010274761.11e-49PREDICTED: myb-related protein 330-like
SwissprotQ9FNV91e-37MY113_ARATH; Transcription factor MYB113
TrEMBLA0A1L2BPG08e-49A0A1L2BPG0_NELNU; MYB transcription factor 5 (Fragment)
TrEMBLA0A1L2BPH71e-48A0A1L2BPH7_NELNU; MYB transcription factor 5 (Fragment)
TrEMBLA0A1U8B2393e-48A0A1U8B239_NELNU; myb-related protein 330-like
STRINGXP_010274761.14e-49(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.15e-40myb domain protein 113
Publications ? help Back to Top
  1. Li T, et al.
    Jasmonic acid enhancement of anthocyanin accumulation is dependent on phytochrome A signaling pathway under far-red light in Arabidopsis.
    Biochem. Biophys. Res. Commun., 2014. 454(1): p. 78-83
    [PMID:25450360]
  2. Mondal SK,Roy S
    Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis.
    J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601
    [PMID:28490275]