PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_016374-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family G2-like
Protein Properties Length: 338aa    MW: 37473.9 Da    PI: 8.9715
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_016374-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.57.3e-29285334251
        G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                    pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ
  NNU_016374-RA 285 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQ 334
                    9************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.804281338IPR017930Myb domain
SuperFamilySSF466891.79E-13282335IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.9E-25283334IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-21285336IPR006447Myb domain, plants
PfamPF002493.6E-6286337IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MFIEPSSVPT PDLSLHISPP NSAPSSICNG NSDQDTTGLD LWRRHDGLRS NSDSSVRPDS  60
QAYTELSLAN PRNGFEAESQ WRRSFTRGGA EEDELRHEQP TDHYSQHHHL RHPNSNRLNH  120
LNHAPSILDA SDGLRPIKGI PVYHNRSFPF IPMERSREKD GKMCFYQMSY PSWSSSLCSS  180
SSPSSVCSSS CPSSASPSSP FMAGGFDPMA ILHSGPNSPS PSSAYRIAAA ASRFNGLSSD  240
TLKPHQLHSL HHPHQYGIGP SDASHAMIRS RFMPKLPTKR NMRAPRMRWT STLHARFVHA  300
VELLGGHERA TPKSVLELMD VKDLTLAHVK SHLQVLLK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-14286334452Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-14286334452Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A4e-14286334351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-14286334351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-14286334351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-14286334351Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-14286334452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-14286334452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-14286334452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-14286334452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-14286334452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-14286334452Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010271157.10.0PREDICTED: transcription repressor KAN1
TrEMBLA0A1U8ATH00.0A0A1U8ATH0_NELNU; transcription repressor KAN1
STRINGXP_010271157.10.0(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.11e-38G2-like family protein