PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_016277-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family G2-like
Protein Properties Length: 313aa    MW: 35266.2 Da    PI: 6.9128
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_016277-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.81e-321972255
        G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                   prlrWtp+LH++Fv+a+e+LGG++kAtPk +l+lm+v gLt++hvkSHLQ+YR+
  NNU_016277-RA 19 PRLRWTPDLHHCFVHAIERLGGQDKATPKLVLQLMDVRGLTISHVKSHLQMYRS 72
                   8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-311575IPR009057Homeodomain-like
PROSITE profilePS5129412.2761575IPR017930Myb domain
SuperFamilySSF466891.97E-151774IPR009057Homeodomain-like
TIGRFAMsTIGR015575.3E-241973IPR006447Myb domain, plants
PfamPF002492.9E-82071IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MGTCGRNGAV RQYIRSKVPR LRWTPDLHHC FVHAIERLGG QDKATPKLVL QLMDVRGLTI  60
SHVKSHLQMY RSMKSDLSRQ DMHSNQQRKH SFDRHDGCVD EENDGGFFSS SKPIQDSDSQ  120
FIYGPLPPKR ARIETTNSIS HNLHCNNQRI CETVVSPYYF HDYLQAMAEN GGIKEGFRWQ  180
AEAPSTSFSL PPHLYNLNAF GYSMEESQFF KMAQVNVEQL PSTRKRKMEN MDNSFQSHLT  240
QSVDKEHTEE EEAGDCTLSL SLSLRPSAQS NASSTSEISE AISSSKDCSG SSQQRHINLD  300
LSISLCGSSV ESV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-182074458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-182074458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A5e-182074357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-182074357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-182074357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-182074357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-182074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-182074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-182074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-182074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-182074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-182074458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1222227TRKRKM
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010270741.10.0PREDICTED: putative Myb family transcription factor At1g14600
TrEMBLA0A1U8ASG40.0A0A1U8ASG4_NELNU; putative Myb family transcription factor At1g14600
STRINGXP_010270741.10.0(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.13e-33G2-like family protein