PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_016117-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB_related
Protein Properties Length: 269aa    MW: 30247.5 Da    PI: 7.1429
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_016117-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.72.1e-164386146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
    NNU_016117-RA 43 RGNITLEEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 86
                     7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.42E-212395IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.9E-102349IPR009057Homeodomain-like
PROSITE profilePS500904.3562437IPR017877Myb-like domain
PROSITE profilePS5129423.2463892IPR017930Myb domain
SMARTSM007171.3E-144290IPR001005SANT/Myb domain
PfamPF002494.2E-154386IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-185087IPR009057Homeodomain-like
CDDcd001671.22E-76386No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MAKVAGTPSL DAQGVLKPGT GLKRTGKSCR LRWLNYLRPD VRRGNITLEE QLLILELHSR  60
WGNRWSKIAQ HLPGRTDNEI KNYWRTRVQK HAKQLQCDVN SKQFKDTMRY LWMPRLVERI  120
RAAAAASSGA NTTTTSPTTT HHQIYNNNSD VITGQVLSSA GSNNEYGVSQ INASFTPENS  180
STAGSSELSV GTQVSPVSDL TDYYNFQPNN YADNFHASQV NYQESLTSPT GYFNQGLDFE  240
AIEQNNMWLG DGDVSDNLWN VEDIWLLQQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-16249040106B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor contributing to the regulation of stamen maturation and male fertility in response to jasmonate signaling. Required for correct timing of anther dehiscence. Acts as a negative regulator of abscisic acid-induced cell death. Not involved in the regulation of BOI. Regulated by MYB21 and at a lower level by MYB24. Negatively regulated by the proteasome in an SCF(COI1) E3 ubiquitin-protein ligase complex-dependent manner. {ECO:0000269|PubMed:14555693, ECO:0000269|PubMed:19091873, ECO:0000269|PubMed:20921156, ECO:0000269|PubMed:23952703}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by jasmonate and pathogen infection. {ECO:0000269|PubMed:14555693, ECO:0000269|PubMed:19091873}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010270853.10.0PREDICTED: transcription factor MYB108
SwissprotQ9LDE11e-66MY108_ARATH; Transcription factor MYB108
TrEMBLA0A1U8B4420.0A0A1U8B442_NELNU; transcription factor MYB108
STRINGXP_010270853.10.0(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06490.13e-67myb domain protein 108
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Cheng HQ, et al.
    The cotton MYB108 forms a positive feedback regulation loop with CML11 and participates in the defense response against Verticillium dahliae infection.
    J. Exp. Bot., 2016. 67(6): p. 1935-50
    [PMID:26873979]
  3. Sanz-Fernández M, et al.
    Screening Arabidopsis mutants in genes useful for phytoremediation.
    J. Hazard. Mater., 2017. 335: p. 143-151
    [PMID:28441590]
  4. Chou ML, et al.
    The Direct Involvement of Dark-Induced Tic55 Protein in Chlorophyll Catabolism and Its Indirect Role in the MYB108-NAC Signaling Pathway during Leaf Senescence in Arabidopsis thaliana.
    Int J Mol Sci, 2018.
    [PMID:29937503]