PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_015819-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family SAP
Protein Properties Length: 515aa    MW: 56259.5 Da    PI: 6.8569
Description SAP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_015819-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SAP684.11.8e-208615141454
            SAP   1 mssssssssse...seegseggeggdassgesegpsssrqraanevwpePflealatqvaidasrslGrlaaasalanvfqvcstwravsrsdllw 93 
                    mssssssssse   ++ g+ + +gg+  +ge+e+psssrqr+ ++vwpePf+eala+qvaida+r++Grlaa +a+anvfqvcstwravsrsdllw
  NNU_015819-RA  61 MSSSSSSSSSEgsaEGGGDVHVHGGQGRGGEFERPSSSRQRSGDGVWPEPFVEALAYQVAIDAARTIGRLAAGPAVANVFQVCSTWRAVSRSDLLW 156
                    56555554443111445566666777777******************************************************************* PP

            SAP  94 qrltrriWrrtkllrdtWreeyiyrhrtarnfrtrrysyvtlqfdpadvdedndadalsCrclalsdkylaaGfadGavrlfdletrlhvstflpq 189
                    ++ltr+iW   +l +dtWr+e+i rhrta nfr rr  y+tl+fd +     nd+d l+Crclalsd +la+Gf dG+vrlfdl++rlhv tf+p+
  NNU_015819-RA 157 HNLTRQIWGADRLQHDTWRDEFISRHRTAFNFRYRRAVYTTLEFDAS----GNDNDGLICRCLALSDVHLACGFLDGTVRLFDLSSRLHVGTFRPH 248
                    *********************************************97....556689*************************************** PP

            SAP 190 hrd.rlGrfsravsGivisdsrlvfatldGdihvavidgagaaaarrallGdvvndGalvdfaGsgrWwvGlyaGvpGrafhiWdaeteelvfvGG 284
                    hrd +lG fsravsGi+++d++lvfa+ldGdihva+i+g+g   +rra+lG v+ndG+lvdf+G++rWwvGl+aGvpGrafh+Wd++teel+fvGG
  NNU_015819-RA 249 HRDdLLGAFSRAVSGIILTDTKLVFASLDGDIHVANIHGVG---TRRAQLGSVLNDGTLVDFSGCARWWVGLFAGVPGRAFHVWDGDTEELMFVGG 341
                    *96379*********************************66...9*************************************************** PP

            SAP 285 sltdPeavmGWhmlteltelvGrvrvteretavaCtslrlvvfdlrnqgvvlreeeerrGlivssldasneayvvvdsrGvatvrrvenleevcrf 380
                    sltdPeav GW +lt l e+vGr+rv++ etavaCt +r++vfdl+nqg++l+eee++rG+ v s+d+ n++++vvd+rG a+vrrv ++eevcrf
  NNU_015819-RA 342 SLTDPEAVIGWRLLTRLGETVGRIRVSGLETAVACTGSRVMVFDLQNQGLILGEEEFERGINVNSVDVCNDVFLVVDNRGLASVRRVGSFEEVCRF 437
                    ************************************************************************************************ PP

            SAP 381 rvrg.aqrg...vlgCvnggyalvyaggvlrvWeiekkegylyslrervgevnalvaddrhvavsssdgtihlldfga 454
                    ++rg a+rg   vlgCvn  ya +++ggv+rvW++++ + yly lrer+ge+ al++d+ +v +sssd+tihl+dfga
  NNU_015819-RA 438 TMRGgAHRGggmVLGCVNSDYAFLCSGGVIRVWDVHHGG-YLYRLRERMGEATALISDESYVVASSSDATIHLWDFGA 514
                    ***9977644459***********************966.*************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF813832.62E-7136186IPR001810F-box domain
Gene3DG3DSA:1.20.1280.501.8E-5137201No hitNo description
SMARTSM0032010197235IPR001680WD40 repeat
Gene3DG3DSA:2.130.10.101.7E-14214305IPR015943WD40/YVTN repeat-like-containing domain
SuperFamilySSF509782.2E-15214512IPR017986WD40-repeat-containing domain
Gene3DG3DSA:2.130.10.101.7E-14353512IPR015943WD40/YVTN repeat-like-containing domain
SMARTSM00320110432471IPR001680WD40 repeat
PROSITE profilePS502949.626465515IPR017986WD40-repeat-containing domain
SMARTSM003209.7474511IPR001680WD40 repeat
PROSITE profilePS500828.904494515IPR001680WD40 repeat
PROSITE patternPS006780498512IPR019775WD40 repeat, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009554Biological Processmegasporogenesis
GO:0009908Biological Processflower development
GO:0030163Biological Processprotein catabolic process
GO:0046622Biological Processpositive regulation of organ growth
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 515 aa     Download sequence    Send to blast
RAPPSLQGGK SAKICEPFTY KNNKDRAYLS VISFAPLSPS PLPLSHPRVR FILLLTFLFL  60
MSSSSSSSSS EGSAEGGGDV HVHGGQGRGG EFERPSSSRQ RSGDGVWPEP FVEALAYQVA  120
IDAARTIGRL AAGPAVANVF QVCSTWRAVS RSDLLWHNLT RQIWGADRLQ HDTWRDEFIS  180
RHRTAFNFRY RRAVYTTLEF DASGNDNDGL ICRCLALSDV HLACGFLDGT VRLFDLSSRL  240
HVGTFRPHHR DDLLGAFSRA VSGIILTDTK LVFASLDGDI HVANIHGVGT RRAQLGSVLN  300
DGTLVDFSGC ARWWVGLFAG VPGRAFHVWD GDTEELMFVG GSLTDPEAVI GWRLLTRLGE  360
TVGRIRVSGL ETAVACTGSR VMVFDLQNQG LILGEEEFER GINVNSVDVC NDVFLVVDNR  420
GLASVRRVGS FEEVCRFTMR GGAHRGGGMV LGCVNSDYAF LCSGGVIRVW DVHHGGYLYR  480
LRERMGEATA LISDESYVVA SSSDATIHLW DFGAL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010270208.10.0PREDICTED: transcriptional regulator STERILE APETALA
SwissprotQ9FKH11e-172SAP_ARATH; Transcriptional regulator STERILE APETALA
TrEMBLB9IAS70.0B9IAS7_POPTR; Transcriptional regulator STERILE APETALA family protein
STRINGAl_scaffold_0007_31721e-171(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35770.11e-170SAP family protein