PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_012954-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family G2-like
Protein Properties Length: 316aa    MW: 35042.1 Da    PI: 7.5737
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_012954-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.36.2e-32240294155
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    k+r+rWtp+LHerFve v++LGG+ekAtPk il+lm+ +gLt+ hvkSHLQkYR+
  NNU_012954-RA 240 KTRIRWTPDLHERFVESVNRLGGAEKATPKGILKLMDSEGLTIFHVKSHLQKYRI 294
                    68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.1E-29238295IPR009057Homeodomain-like
SuperFamilySSF466891.2E-16238294IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-23240295IPR006447Myb domain, plants
PfamPF002493.5E-7244293IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MNTRKTQFQE LNNGFASDYS FESFGRTYEN FTSQQPLNMG ACFQSPMPAL DGGSLQPNLR  60
PSNLASTISS HFGPPNSAFY ATERYMGFPQ YQYQSTRPCF SELPKNYEEP FSVNSERCDD  120
LDLQSRDSLQ SIVKLPFCSN QNARFSDISN QSSYTNFPGV ELHPLLPSKL MGEDATLDNR  180
NPSNPYKRNQ NPRIGYNPAT SPLAQPSLHV QSEKHALRPS GGVSVASGST VTSGAAPSSK  240
TRIRWTPDLH ERFVESVNRL GGAEKATPKG ILKLMDSEGL TIFHVKSHLQ KYRIAKYIPE  300
SAEGESLSPI SLLLVD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-26240297259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-26240297259Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-26240297158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-26240297158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-26240297158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-26240297158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-26240297259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-26240297259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-26240297259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-26240297259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-26240297259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-26240297259Protein PHOSPHATE STARVATION RESPONSE 1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010265860.10.0PREDICTED: myb family transcription factor PHL5-like
TrEMBLA0A1U8ASR30.0A0A1U8ASR3_NELNU; myb family transcription factor PHL5-like
STRINGXP_010265860.10.0(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.24e-35G2-like family protein