PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_012707-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family G2-like
Protein Properties Length: 364aa    MW: 40193.6 Da    PI: 8.1441
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_012707-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.91.9e-32196251156
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                    kpr++W+peLH+rF++a++qLGGs+ AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  NNU_012707-RA 196 KPRRCWSPELHRRFLNALQQLGGSHAATPKQIRELMKVDGLTNDEVKSHLQKYRLH 251
                    79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.819193253IPR017930Myb domain
SuperFamilySSF466891.66E-18194254IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.3E-29194254IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-27196251IPR006447Myb domain, plants
PfamPF002491.4E-7198249IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MDNFAEKMQR CQTYMEALEE ERRKIQVFQR ELPLCLELVT QAIETCRQQL ATSTEYFPGP  60
TECSEQTSSE GPVLEEFIPL KRSSSSEEEE ELNKPNNKDR NDKKADWLKS VQLWNQAPDP  120
PLKQDLGPKL SVVETKKSGG AFHPFERDTK RVTKPTATSV AAAPSTAQAT ATTSSTAETI  180
TDDSRRDGKE GQSHRKPRRC WSPELHRRFL NALQQLGGSH AATPKQIREL MKVDGLTNDE  240
VKSHLQKYRL HTRRPSPAIH SNGNQQTPQF VVVGGLWVPP PDYAAVTATK REANGVAANG  300
IYAPVAPQPV PESCSQQQKK QKQSPQSSLQ SEGRSSGQRD DDAHSNSPSA SSSTHTTAAA  360
SPSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A6e-13196249255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B6e-13196249255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A6e-13196249154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-13196249154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-13196249154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-13196249154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A6e-13196249255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C6e-13196249255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D6e-13196249255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F6e-13196249255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H6e-13196249255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J6e-13196249255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phosphate signaling in roots. {ECO:0000250|UniProtKB:Q9FX67}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010265235.10.0PREDICTED: myb family transcription factor EFM
SwissprotQ9FPE81e-104HHO3_ARATH; Transcription factor HHO3
TrEMBLA0A1U8AE550.0A0A1U8AE55_NELNU; myb family transcription factor EFM
STRINGXP_010265235.10.0(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.12e-93G2-like family protein
Publications ? help Back to Top
  1. Nagarajan VK,Satheesh V,Poling MD,Raghothama KG,Jain A
    Arabidopsis MYB-Related HHO2 Exerts a Regulatory Influence on a Subset of Root Traits and Genes Governing Phosphate Homeostasis.
    Plant Cell Physiol., 2016. 57(6): p. 1142-52
    [PMID:27016098]