PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_012506-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family G2-like
Protein Properties Length: 474aa    MW: 52814.7 Da    PI: 5.2477
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_012506-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like110.58.6e-35239293155
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    kpr+rWtpeLHe+Fveav+qLGGse+AtPk +l+lmkv+gLt++hvkSHLQkYR+
  NNU_012506-RA 239 KPRMRWTPELHECFVEAVNQLGGSERATPKGVLKLMKVEGLTIYHVKSHLQKYRT 293
                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.892236296IPR017930Myb domain
SuperFamilySSF466892.51E-18237293IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-32238295IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-25239293IPR006447Myb domain, plants
PfamPF002493.2E-10241292IPR001005SANT/Myb domain
PfamPF143798.1E-26324371IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 474 aa     Download sequence    Send to blast
MSSSLPVLPT PLEEKYPKLP DSQQVSLERE IMANSVPPHA TQLASNSGVV GHMFSSASGF  60
TTDLHFSSAP HERHFTNAPF ISQSSSDGIS LPLTRSSHSG VFQSRPMSHY PRENNNISWS  120
ADQLQSFLDF PENVPTQNNQ VESSNSGIMP SDDNTKRSDW QEWADQLIRD DDPSTPNWNE  180
LLADTNVADT ELETAYQAPK PPQNFLVQQP QVHQQIPVLS GDLSSVASPS SSVTGVPNKP  240
RMRWTPELHE CFVEAVNQLG GSERATPKGV LKLMKVEGLT IYHVKSHLQK YRTARYRPDS  300
SEGSSEKKMS AIEEMTSLDL KTGIEITEAL RLQMEVQKRL HEQLEIQRNL QLRIEEQGRY  360
LQMMFEKQCK SHNDRLKTLS SNLEESSAPL LDVMQHSAKN EVEPTKSCAE TGNDIMDASA  420
IPEESSRKMS RKQKEPESHS EDLNLEGVSG SDSPPIKRVK ADDRSVASAK LASD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A7e-32239297260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B7e-32239297260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A7e-32239297260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C7e-32239297260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D7e-32239297260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F7e-32239297260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H7e-32239297260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J7e-32239297260Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as central integrator of phosphate starvation responses (PubMed:20838596). Regulates FER1 expression upon phosphate starvation, linking iron and phosphate homeostasis (PubMed:23788639). {ECO:0000269|PubMed:20838596, ECO:0000269|PubMed:23788639}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00532DAPTransfer from AT5G29000Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not up-regulated by Pi starvation. {ECO:0000269|PubMed:26586833}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010264912.10.0PREDICTED: protein PHOSPHATE STARVATION RESPONSE 1 isoform X2
SwissprotQ8GUN51e-105PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A1U8ABU50.0A0A1U8ABU5_NELNU; protein PHOSPHATE STARVATION RESPONSE 1 isoform X2
STRINGXP_010264910.10.0(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.21e-104G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Bonnot C, et al.
    A chemical genetic strategy identify the PHOSTIN, a synthetic molecule that triggers phosphate starvation responses in Arabidopsis thaliana.
    New Phytol., 2016. 209(1): p. 161-76
    [PMID:26243630]
  4. Aleksza D,Horváth GV,Sándor G,Szabados L
    Proline Accumulation Is Regulated by Transcription Factors Associated with Phosphate Starvation.
    Plant Physiol., 2017. 175(1): p. 555-567
    [PMID:28765275]