PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_012286-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family G2-like
Protein Properties Length: 381aa    MW: 43071.9 Da    PI: 8.0892
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_012286-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1017.6e-3281134255
        G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    prlrWtp+LH +Fv+ave+LGG+++AtPk +l+lm++kgLt++hvkSHLQ+YR+
  NNU_012286-RA  81 PRLRWTPDLHLCFVHAVERLGGQDRATPKLLLNLMNIKGLTIAHVKSHLQMYRS 134
                    8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.06277137IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-2977135IPR009057Homeodomain-like
SuperFamilySSF466891.09E-1480135IPR009057Homeodomain-like
TIGRFAMsTIGR015575.6E-2381136IPR006447Myb domain, plants
PfamPF002493.5E-882133IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MMNSVILSEG KREEREMKES GDTEGSETNK YPSDKNEDEE VNCESKPKNG GSSSNSTVEQ  60
NDQRSSATAG SVRQYNRSKL PRLRWTPDLH LCFVHAVERL GGQDRATPKL LLNLMNIKGL  120
TIAHVKSHLQ MYRSKKIDEA GQVIPEHRHF VEVGDRHMYN LTQLPMLQRF NQRTSSCSFR  180
YEETSWRGNG NWISCAPYMV EATTRSGYHG SLSRSNFSLN SGKLTPTPDF NLDISPFEHA  240
TKITHESRAR LSPFHHPKSW QTPINPNPTE TNPTTQLWDN GREQMGCLNN SIIPEASWNI  300
TVEEKNTEKR KASDCNLDLN LSLELTPRRD KCTRNSEDVE VGSSFSLSLF SSSSSKQFSR  360
LKGGDDSRKL ARSASTLDLT I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A7e-1782136458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B7e-1782136458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A5e-1782136357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-1782136357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-1782136357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-1782136357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A7e-1782136458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C7e-1782136458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D7e-1782136458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F7e-1782136458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H7e-1782136458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J7e-1782136458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010264566.10.0PREDICTED: two-component response regulator ARR18-like
TrEMBLA0A1U8ACI00.0A0A1U8ACI0_NELNU; two-component response regulator ARR18-like
STRINGXP_010264566.10.0(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.11e-46G2-like family protein