PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_012216-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family TCP
Protein Properties Length: 114aa    MW: 12494.5 Da    PI: 10.4874
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_012216-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP98.89.6e-31483383
            TCP  3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssas 83
                   gk+ +++++hTkv+gR+ R+ ++++caar+F+L++eLG+++d+++i WLl+ a+pai++ tg ++ +  ++ +++   +  
  NNU_012216-RA  4 GKRASTKDRHTKVEGRGCRIWMPSTCAARIFQLTRELGHKSDGENIRWLLEHAEPAIIASTGIDTMPTIAM-SVDGTLKIP 83
                   799************************************************************66666333.111111111 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.6E-24888IPR005333Transcription factor, TCP
PROSITE profilePS5136921.775963IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 114 aa     Download sequence    Send to blast
MVLGKRASTK DRHTKVEGRG CRIWMPSTCA ARIFQLTREL GHKSDGENIR WLLEHAEPAI  60
IASTGIDTMP TIAMSVDGTL KIPTTSLASD KDTTKKNRKR SVSSETIGAM AILQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010255575.16e-53PREDICTED: transcription factor TCP9
RefseqXP_010272585.17e-53PREDICTED: transcription factor TCP9-like
SwissprotO646472e-47TCP9_ARATH; Transcription factor TCP9
TrEMBLA0A1U7ZTX91e-51A0A1U7ZTX9_NELNU; transcription factor TCP9
TrEMBLA0A1U8B0K02e-51A0A1U8B0K0_NELNU; transcription factor TCP9-like
STRINGXP_010255575.12e-52(Nelumbo nucifera)
STRINGXP_010272585.13e-52(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45680.11e-49TCP family protein