PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_011816-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family G2-like
Protein Properties Length: 334aa    MW: 37269.8 Da    PI: 6.9105
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_011816-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.17.3e-32134187255
        G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    pr+rWt++LH++Fv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  NNU_011816-RA 134 PRMRWTTTLHAHFVHAVELLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 187
                    9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.68E-16130188IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-28132188IPR009057Homeodomain-like
TIGRFAMsTIGR015573.6E-23134187IPR006447Myb domain, plants
PfamPF002492.2E-7135186IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MFSSSHSMRT ALPFPDLSLQ ISPPVIPDCE VKDMSYDGWM KKTLHSDRTS TTDSGSSGSD  60
VTYEQGGFLH FERGYDLRGS EPTLSLGFET AALNPPLMQP PSNLHYLQQP QIYGRDFKRN  120
SRMVNGGKRC VRAPRMRWTT TLHAHFVHAV ELLGGHERAT PKSVLELMNV KDLTLAHVKS  180
HLQMYRTVKS TDKGAGQGQS EMGLIQRSEA VEVEGGISSC ERSDPNPFSY SLNPSPPPPK  240
SPRGSWSSME KNGWSPSAKE SGLMPYPFEP TDLTNEKNQV VGANHFASQN EREKLYLSSL  300
ESSDVRPNLE FTLGRQSWQM DYAEPSNELT LLKC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-16135189458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-16135189458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-16135189357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-16135189357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-16135189357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-16135189357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-16135189458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-16135189458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-16135189458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-16135189458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-16135189458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-16135189458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010263804.10.0PREDICTED: probable transcription factor KAN4
TrEMBLA0A1U8A8V60.0A0A1U8A8V6_NELNU; probable transcription factor KAN4
STRINGXP_010263804.10.0(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.11e-65G2-like family protein