PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_011780-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family G2-like
Protein Properties Length: 370aa    MW: 41064.1 Da    PI: 6.2809
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_011780-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like51.52.2e-162522812756
        G2-like  27 AtPktilelmkvkgLtlehvkSHLQkYRla 56 
                    AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  NNU_011780-RA 252 ATPKQIRELMKVDGLTNDEVKSHLQKYRLH 281
                    9***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.33E-6251284IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-13251281IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.6E-14252284IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MGSTSPELSL DFKPTYVPQT ISGFLRELST IGDISQRSSK LDDYVKRLEE EMKKIEAFKR  60
ELPLCMLLLN DAIVSLKEEG MQCTTSNVRP VMEEFIPLKR NSDEDVRAKK EKESRDKKNW  120
MSSAQLWSSS GYSNQDTSYD RNQKSVVDGK EVTEPEDHSV PENPFQSCKY RSRGGAFMPF  180
KGYTGFPTTP LKEDKEVLPV PALSLFTPGI KTPRHEPNPS CLNSKNSLAT ATTNFEEAKE  240
MLVPRVTSSF LATPKQIREL MKVDGLTNDE VKSHLQKYRL HTRRLPAASS PANQSVVVLG  300
GLWMPQDQFG ASSKPSSASQ SGSPQGPLQL AGTAGGISTT GGDSMEDDED RRSESYSWKG  360
HLHKSGEDDV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010263747.10.0PREDICTED: myb family transcription factor EFM
TrEMBLA0A1U8AMS40.0A0A1U8AMS4_NELNU; myb family transcription factor EFM
STRINGXP_010263747.10.0(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.12e-48G2-like family protein