PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_011009-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB_related
Protein Properties Length: 140aa    MW: 15957.9 Da    PI: 6.7879
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_011009-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.22.1e-191663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd+ll ++v+++G g+W+++ar  g++R +k+c++rw +yl
    NNU_011009-RA 16 KGPWTAEEDKLLTEYVRLHGEGRWNSVARFAGLKRNGKSCRLRWVNYL 63
                     79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.1071167IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-231266IPR009057Homeodomain-like
SMARTSM007172.2E-161565IPR001005SANT/Myb domain
PfamPF002498.4E-181663IPR001005SANT/Myb domain
SuperFamilySSF466892.97E-231790IPR009057Homeodomain-like
CDDcd001674.32E-121863No hitNo description
Gene3DG3DSA:1.10.10.603.2E-76790IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 140 aa     Download sequence    Send to blast
MAGRLGWGIL EEGWRKGPWT AEEDKLLTEY VRLHGEGRWN SVARFAGLKR NGKSCRLRWV  60
NYLRPDLKRG QITPYEERII MELHARWGNS SASVQEASSE EILWGDLWNL DDIHANLDTA  120
CSTSKASLPN LVTSSPSEFN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-15169427104MYB TRANSFORMING PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in abiotic stress responses. Plays a regulatory role in tolerance to salt, cold, and drought stresses. Regulates positively the expression of genes involved in proline synthesis and transport, and genes involved in reactive oxygen species (ROS) scavenging such as peroxidase, superoxide dismutase and catalase during salt stress. Transactivates stress-related genes, including LEA3, RAB16A and DREB2A during salt stress. {ECO:0000269|PubMed:22301384}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salt, cold and osmotic stresses, and abscisic acid (ABA). Down-regulated by salicylic acid (SA). {ECO:0000269|PubMed:22301384}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010262476.13e-60PREDICTED: transcription factor MYB59-like
SwissprotQ10MB48e-35MYB2_ORYSJ; Transcription factor MYB2
TrEMBLA0A1U8AB058e-59A0A1U8AB05_NELNU; transcription factor MYB59-like
STRINGXP_010262476.11e-59(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24310.11e-48myb domain protein 305
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Yang A,Dai X,Zhang WH
    A R2R3-type MYB gene, OsMYB2, is involved in salt, cold, and dehydration tolerance in rice.
    J. Exp. Bot., 2012. 63(7): p. 2541-56
    [PMID:22301384]
  3. Chen X, et al.
    The NAC family transcription factor OsNAP confers abiotic stress response through the ABA pathway.
    Plant Cell Physiol., 2014. 55(3): p. 604-19
    [PMID:24399239]
  4. Lv Y, et al.
    New insights into the genetic basis of natural chilling and cold shock tolerance in rice by genome-wide association analysis.
    Plant Cell Environ., 2016. 39(3): p. 556-70
    [PMID:26381647]
  5. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4
    [PMID:26834774]