PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_008768-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB_related
Protein Properties Length: 335aa    MW: 36739.7 Da    PI: 7.4317
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_008768-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.42.8e-1298142347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+  ++ + ++lG+g+W+ Iar     Rt+ q+ s+ qky
    NNU_008768-RA  98 PWTEEEHRMFLLGLQKLGKGDWRGIARNYVISRTPTQVASHAQKY 142
                      8*****************************89************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.93991147IPR017930Myb domain
SuperFamilySSF466897.18E-1793148IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-1994146IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.9E-1195141IPR009057Homeodomain-like
SMARTSM007178.0E-1195145IPR001005SANT/Myb domain
PfamPF002491.1E-1098142IPR001005SANT/Myb domain
CDDcd001672.63E-998143No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MTRRCSHCSH NGHNSRTCPN RGVKIFGVRL TDGSIRKSAS MGNLTHYTGS SNNNHQHNNT  60
LGSPGETPEH GASADGYASE DFVQGSSSSC RERKKGVPWT EEEHRMFLLG LQKLGKGDWR  120
GIARNYVISR TPTQVASHAQ KYFIRQSNVS RRKRRSSLFD IVTDESVDIP PVVSQELFPI  180
NHPQAETQSN NPLPVPPALD EECESMDSAT NSNDGEAVLP KPESTQSSYP VVFPAYFSPF  240
FPFSFPFWPG YNTEAMTKET YEIVKPTAIH SKSPINVDEL VGMSKLSLGE SLANSGPSSL  300
SLQLVEGSTR QSAFHASSAT GHSSMDRNSN PIHAV
Functional Description ? help Back to Top
Source Description
UniProtTranscription repressor that binds to 5'-TATCCA-3' elements in gene promoters. Contributes to the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Transcription repressor involved in a cold stress response pathway that confers cold tolerance. Suppresses the DREB1-dependent signaling pathway under prolonged cold stress. DREB1 responds quickly and transiently while MYBS3 responds slowly to cold stress. They may act sequentially and complementarily for adaptation to short- and long-term cold stress (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by sucrose and gibberellic acid (GA) (PubMed:12172034). Induced by cold stress in roots and shoots. Induced by salt stress in shoots. Down-regulated by abscisic aci (ABA) in shoots (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010258818.10.0PREDICTED: transcription factor MYB1R1
SwissprotQ7XC571e-138MYBS3_ORYSJ; Transcription factor MYBS3
TrEMBLA0A1U8A9V80.0A0A1U8A9V8_NELNU; transcription factor MYB1R1
STRINGXP_010258818.10.0(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.11e-116MYB_related family protein
Publications ? help Back to Top
  1. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]
  2. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  3. Su CF, et al.
    A novel MYBS3-dependent pathway confers cold tolerance in rice.
    Plant Physiol., 2010. 153(1): p. 145-58
    [PMID:20130099]