PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_008138-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family G2-like
Protein Properties Length: 415aa    MW: 46767.4 Da    PI: 7.225
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_008138-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like108.14.8e-343387155
        G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                   kprl+WtpeLHerFveav+qLGG +kAtPkt+++lm++ gLtl+h+kSHLQkYRl
  NNU_008138-RA 33 KPRLKWTPELHERFVEAVNQLGGVDKATPKTVMKLMGISGLTLYHLKSHLQKYRL 87
                   79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.6643090IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.9E-323188IPR009057Homeodomain-like
SuperFamilySSF466893.58E-173288IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-233388IPR006447Myb domain, plants
PfamPF002494.7E-103586IPR001005SANT/Myb domain
PfamPF143791.8E-24142188IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MYHHHQGKTS FPSSRMSINV RGDTGLVLST DAKPRLKWTP ELHERFVEAV NQLGGVDKAT  60
PKTVMKLMGI SGLTLYHLKS HLQKYRLSKN LHGQANTGIN KNAVAGDRIS EASGAFISNT  120
SLCSQTNKEY ELKRISNIRS LQISEAIQMQ IEVQRRLHEQ LEVQRHLQLR IEAQGKYLQS  180
VLEKAQETLG RQNLGSAGLE AAKVQLSELV SKVSTECLNS TLSELKELQD LHPQKTQTTQ  240
PTDCSMDSCL TSCEGSQKDQ EIHNIGVGLR SYYSNTSLGQ KEIVDDSRLE QPEHAWGEDQ  300
NENKMFCSSK GRDTERIMFP MKRNSSDLTM SIKVHGEKWN ASSFFTEATT KEGDEDDSFH  360
YQTGARRPVT NVENEKMSKG FRLPHLTPKL DLNSQEENDS TSTCKQFDLN GFSWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-213289158Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-213289158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A5e-213389157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-213389157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-213389157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-213389157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-213289158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-213289158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-213289158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-213289158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-213289158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-213289158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that may act on the GAL1 promoter (PubMed:12008900). Acts redundantly with MYR2 as a repressor of flowering and organ elongation under decreased light intensity (PubMed:21255164). Represses gibberellic acid (GA)-dependent responses and affects levels of bioactive GA (PubMed:21255164). {ECO:0000269|PubMed:21255164, ECO:0000305|PubMed:12008900}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010257717.10.0PREDICTED: myb-related protein 2-like isoform X1
SwissprotQ9FK471e-130PHLA_ARATH; Myb-related protein 1
TrEMBLA0A1U7ZTQ30.0A0A1U7ZTQ3_NELNU; myb-related protein 2-like isoform X1
STRINGXP_010257717.10.0(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18240.41e-133myb-related protein 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]