PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_007976-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family G2-like
Protein Properties Length: 431aa    MW: 48437.9 Da    PI: 6.2985
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_007976-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.42.5e-31249303155
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    k+r+rWtp+LHerFve v++LGG+ekAtPk il+lm  +gLt+ hvkSHLQkYR+
  NNU_007976-RA 249 KTRIRWTPDLHERFVESVNRLGGAEKATPKGILKLMASEGLTIFHVKSHLQKYRI 303
                    68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-28247304IPR009057Homeodomain-like
SuperFamilySSF466892.87E-16247303IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-23249304IPR006447Myb domain, plants
PfamPF002499.5E-7253302IPR001005SANT/Myb domain
PfamPF143794.3E-22332379IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 431 aa     Download sequence    Send to blast
MNNRKVEYQG LNNECVSDYS FESFDRSSGD FGSRQTWNMG ACFHSPIPAL EGGSLQPNPR  60
PSALGSSTIS SHYGLPTSAF YATERYMGFP QYQGARSWFS EFLKNYDQAV SSCEPSEEPF  120
SVDPERRDDL DLQPRDTLQS VMELPFCSNQ NSRFSEISNT SSYRNFPGIE PHPLLRHKLV  180
GEDATLNSRH PSILFEVNQN PGVGYKPVTS PLAQTSFNVQ LEKQSPIPPA VVSVASGSIV  240
SAGAAVSNKT RIRWTPDLHE RFVESVNRLG GAEKATPKGI LKLMASEGLT IFHVKSHLQK  300
YRIAKYMPES SEGRSERACI NSMAQIDAKT GMQITEALRL QLDVQKRLHE QLEIQRNLQM  360
RIEEQGRQLK KMFEQQQKAN KNWFETQNLD IMFPDDQSNS HEDAQVSTVG EGSEDANFTS  420
KTDNQNTSHP R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-25249306259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-25249306259Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-25249306158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-25249306158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-25249306158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-25249306158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-25249306259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-25249306259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-25249306259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-25249306259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-25249306259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-25249306259Protein PHOSPHATE STARVATION RESPONSE 1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010257443.10.0PREDICTED: protein PHOSPHATE STARVATION RESPONSE 3-like
TrEMBLA0A1U7ZUX70.0A0A1U7ZUX7_NELNU; protein PHOSPHATE STARVATION RESPONSE 3-like
STRINGXP_010257440.10.0(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.17e-68G2-like family protein