PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_007791-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family G2-like
Protein Properties Length: 121aa    MW: 13450.2 Da    PI: 6.7875
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_007791-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like93.81.4e-2965114251
        G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                    prlrWtpeLH +Fv+ave+LGG+++AtPk +l+lm++kgL+++hvkSHLQ
  NNU_007791-RA  65 PRLRWTPELHLCFVQAVERLGGQDRATPKLVLQLMNIKGLSISHVKSHLQ 114
                    8************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-2761114IPR009057Homeodomain-like
PROSITE profilePS5129411.23161121IPR017930Myb domain
SuperFamilySSF466893.05E-1463115IPR009057Homeodomain-like
TIGRFAMsTIGR015575.9E-2265115IPR006447Myb domain, plants
PfamPF002499.3E-1066115IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 121 aa     Download sequence    Send to blast
MQGEGCENND GLKENPSNKS EDEEGDDEVM PKTSASSSNS TVEESEKKPS SGEGKMRQYI  60
RSKMPRLRWT PELHLCFVQA VERLGGQDRA TPKLVLQLMN IKGLSISHVK SHLQVILVGR  120
V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A9e-1966114452Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B9e-1966114452Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A8e-1966114351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B8e-1966114351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C8e-1966114351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D8e-1966114351Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A9e-1966114452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C9e-1966114452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D9e-1966114452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F9e-1966114452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H9e-1966114452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J9e-1966114452Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010257082.19e-77PREDICTED: uncharacterized protein LOC104597310
SwissprotQ700D91e-25MYBF_ARATH; Putative Myb family transcription factor At1g14600
TrEMBLA0A1U7ZXR52e-75A0A1U7ZXR5_NELNU; uncharacterized protein LOC104597310
STRINGXP_010257082.14e-76(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.11e-31G2-like family protein