PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_007790-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family G2-like
Protein Properties Length: 370aa    MW: 41560.9 Da    PI: 8.3437
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_007790-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.51.3e-3266119255
        G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    prlrWtp+LH +Fv+ave+LGG+++AtPk +l+lm++kgLt++hvkSHLQ+YR+
  NNU_007790-RA  66 PRLRWTPDLHLCFVHAVERLGGQDRATPKLVLNLMNIKGLTIAHVKSHLQMYRS 119
                    8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.08462122IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-3162120IPR009057Homeodomain-like
SuperFamilySSF466895.2E-1564120IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-2366121IPR006447Myb domain, plants
PfamPF002494.1E-967118IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MKETSNSSEG SKTNHSDKHE DEEEDEEVDC NDKPKNGGSS SNSTVEENEK KAGTGSVRQY  60
VRSKMPRLRW TPDLHLCFVH AVERLGGQDR ATPKLVLNLM NIKGLTIAHV KSHLQMYRSK  120
KIDDAGQVIT DQQRHYVEAA DRHIYNLSQL PMLQGFNQRP ASSFRYEEAS WNNHGNWMSN  180
PYIGEATNRP SGFYSSVATR NFSLNSSKAP NRDDFQMGSS PFGHSIKMTH ETRGDFSLFR  240
QHESWQTPTF RPSPITKPNP TTQFRGSGLE QAVRLNNSIT PETNWRIAVE EKNPGKRKAS  300
DCDLDLNLSL KIASRHDECP RSSEDVGVGS SLSLSLFPSP PSSSRLSRLK EGDDSRNKHA  360
RTASTLDLTI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-1767121458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-1767121458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-1767121357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-1767121357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-1767121357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-1767121357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-1767121458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-1767121458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-1767121458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-1767121458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-1767121458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-1767121458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010257080.10.0PREDICTED: two-component response regulator ARR14-like
RefseqXP_010257081.10.0PREDICTED: two-component response regulator ARR14-like
TrEMBLA0A1U8A6Q80.0A0A1U8A6Q8_NELNU; two-component response regulator ARR14-like
STRINGXP_010257080.10.0(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.15e-57G2-like family protein