PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_007543-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB_related
Protein Properties Length: 125aa    MW: 12888.2 Da    PI: 7.9142
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_007543-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.81e-1761106147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+W++eEd +l ++v ++G ++W++Iar +  gR++k+c++rw + 
    NNU_007543-RA  61 KGPWSPEEDAILSRLVSKFGARNWSLIARGIA-GRSGKSCRLRWCNQ 106
                      79******************************.***********985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.6456111IPR017930Myb domain
SMARTSM007173.2E-1560109IPR001005SANT/Myb domain
PfamPF002495.9E-1761106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-2362117IPR009057Homeodomain-like
SuperFamilySSF466896.76E-1862117IPR009057Homeodomain-like
CDDcd001675.42E-1663105No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 125 aa     Download sequence    Send to blast
MEEEIVVAGD VCTGGDGAGS DSGAVGSGGD DAERGSGIGV VVGDGSGSSS RVGRGSEDRV  60
KGPWSPEEDA ILSRLVSKFG ARNWSLIARG IAGRSGKSCR LRWCNQLDPS VKRKPFTGSV  120
NCFQR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-1755117163B-MYB
Search in ModeBase
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Slightly induced by salicylic acid. {ECO:0000269|PubMed:16463103}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010256736.14e-74PREDICTED: uncharacterized protein LOC104597048 isoform X1
SwissprotQ425751e-26MYB1_ARATH; Transcription factor MYB1
TrEMBLA0A1U8A4M59e-73A0A1U8A4M5_NELNU; uncharacterized protein LOC104597048 isoform X1
STRINGXP_010256736.12e-73(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.11e-28myb domain protein 109
Publications ? help Back to Top
  1. Wang T, et al.
    Salt-Related MYB1 Coordinates Abscisic Acid Biosynthesis and Signaling during Salt Stress in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1027-41
    [PMID:26243618]
  2. Nguyen HT, et al.
    A Transcription Factor γMYB1 Binds to the P1BS cis-Element and Activates PLA2-γ Expression with its Co-Activator γMYB2.
    Plant Cell Physiol., 2016. 57(4): p. 784-97
    [PMID:26872838]
  3. Sanz-Fernández M, et al.
    Screening Arabidopsis mutants in genes useful for phytoremediation.
    J. Hazard. Mater., 2017. 335: p. 143-151
    [PMID:28441590]
  4. Verma N,Burma PK
    Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum.
    Plant J., 2017. 92(3): p. 481-494
    [PMID:28849604]