PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_006931-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family G2-like
Protein Properties Length: 285aa    MW: 32200.6 Da    PI: 9.1956
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_006931-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.82.5e-332175155
        G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                   kprlrWtp+LH+rFv+av++LGG++kAtPk++l++m++kgLtl+h+kSHLQkYRl
  NNU_006931-RA 21 KPRLRWTPDLHDRFVDAVTKLGGPDKATPKSVLRVMGLKGLTLYHLKSHLQKYRL 75
                   79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.7811878IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.2E-321876IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-242176IPR006447Myb domain, plants
SuperFamilySSF466894.3E-162177IPR009057Homeodomain-like
PfamPF002496.2E-92374IPR001005SANT/Myb domain
PfamPF143791.4E-24125171IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MERTCGSYAL ETGMVLSRDP KPRLRWTPDL HDRFVDAVTK LGGPDKATPK SVLRVMGLKG  60
LTLYHLKSHL QKYRLGKQSK KGTNIEQAKS EELSVDSVGD SGYNHMHFSA TSSSTSKENS  120
ERGIPIAEAL RYQIEVQRRL QEQLEVQKKL QIRIEAQGKY LQAILEKAQK SLSTDTKCPR  180
SLEATRAQLT DFNLALSGLM ENMNQVREDE SKGEMIGKSL LNDNQENNHS SGFQLYRELE  240
EAKKKEIKIK VEESSLLFDL NVKGGYDFLG PKGSELDPNM NIQRI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-192177157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-192177157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-192177157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-192177157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00544DAPTransfer from AT5G45580Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010255718.10.0PREDICTED: myb family transcription factor PHL11 isoform X1
RefseqXP_010255719.10.0PREDICTED: myb family transcription factor PHL11 isoform X1
SwissprotC0SVS43e-79PHLB_ARATH; Myb family transcription factor PHL11
TrEMBLA0A1U8A2380.0A0A1U8A238_NELNU; myb family transcription factor PHL11 isoform X1
STRINGXP_010255718.10.0(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.13e-65G2-like family protein
Publications ? help Back to Top
  1. Petridis A,Döll S,Nichelmann L,Bilger W,Mock HP
    Arabidopsis thaliana G2-LIKE FLAVONOID REGULATOR and BRASSINOSTEROID ENHANCED EXPRESSION1 are low-temperature regulators of flavonoid accumulation.
    New Phytol., 2016. 211(3): p. 912-25
    [PMID:27125220]